Recombinant Orangutan hepatitis B virus Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Critical Functional Motifs:

  • NTCP Binding Site: Residues 1–48 of pre-S1 .

  • Fusion Peptide: Hydrophobic region (residues 50–70) .

  • Capsid Interaction Site: Pre-S1/Pre-S2 border (residues 90–120) .

Host Specificity and Infectivity

Chimeric studies with primate hepadnaviruses (e.g., HBV, WMHBV) highlight the pre-S1 domain’s role in determining host tropism. For example:

  • Substituting residues 1–30 of HBV pre-S1 into WMHBV restores infectivity in human hepatocytes .

  • Conversely, replacing HBV residues 21–30 with WMHBV sequences reduces infectivity by 98% .

These findings suggest that the Orangutan HBV L protein’s pre-S1 domain likely governs its unique host range, analogous to human and woolly monkey HBV variants .

Comparative Analysis of Primate HBV L Proteins

FeatureOrangutan HBV L Human HBV L WMHBV L
Pre-S1 Length119 residues108–119 residues119 residues
MyristoylationYesYesYes
NTCP Binding RegionResidues 1–48Residues 1–48Residues 1–48
Host TropismOrangutan/PrimateHumanWoolly Monkey

Applications in Virology and Therapeutics

  1. Vaccine Development: The L protein’s antigenic loops are targets for neutralizing antibodies, making it a candidate for next-generation vaccines .

  2. Receptor Studies: Synthetic pre-S1 peptides (e.g., residues 5–20) inhibit HBV entry, aiding receptor identification .

  3. Antiviral Screening: Used to evaluate entry inhibitors targeting NTCP or fusion mechanisms .

Challenges and Future Directions

  • Structural Resolution: The intrinsically disordered pre-S domain complicates crystallographic studies .

  • Host Adaptation Mechanisms: Further chimeric studies are needed to map residues dictating Orangutan HBV specificity .

This recombinant protein remains a vital tool for probing cross-species viral transmission and refining therapies against HBV and related hepatoviruses.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To ensure optimal protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize its inclusion in the manufacturing process.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Orangutan hepatitis B virus (isolate Somad) (HBVoru)
Target Names
S
Target Protein Sequence
GQNLSVTNPLGFFPEHQLDPLFRANTNNPDWDFNPNKDTWPEATKVGVGAFGPGFTPPHG GLLGWSPQAQGVTTILPAVPPPASTNRQSGRRPTPISPPLRDTHPQAMQWNSTVFHQALQ DPRVRGLYFPAGGSSSGTVSPVPTTASPISSTFLKTGDPALNMESISSGFLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSLTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTTTTSVGPCRTCTISAPGTSLFPSCC CTKPSDGNCTCIPIPPSWAFAKFLWGWASVRFSWLNLLVPFVQWFAGLSPTVWLSVIWMI WYWGPSLYNILSPFIPLLPIFFCLWAYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: 'external' or Le-HBsAg and 'internal' or Li-HBsAg. In its external conformation, the protein binds to cell receptors, initiating infection. This interaction dictates the species specificity and liver tropism. The attachment triggers virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein also facilitates fusion between the virion membrane and the endosomal membrane. In its internal conformation, the protein plays a crucial role in virion morphogenesis and mediates contact with the nucleocapsid, acting similar to a matrix protein. The middle envelope protein plays a vital role in virion budding. It promotes budding independently of the nucleocapsid, leading to the formation of subviral lipoprotein particles, 22 nm in diameter, that lack a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What is Orangutan Hepatitis B Virus and how does it relate to human HBV variants?

Orangutan Hepatitis B Virus (OHV) represents a distinct hepadnavirus that naturally infects orangutans (Pongo pygmaeus) but is clearly divergent from the six known human HBV genotypes and other nonhuman hepadnaviruses. Phylogenetic analyses have revealed geographic clustering with Southeast Asian genotype C viruses and gibbon ape HBV, implying a common origin of infection within this geographic region, with potential cross-species transmission events among hominoids . The genetic relationships between OHV and other primate hepadnaviruses provide valuable evolutionary insights, suggesting that extensive recombination events have occurred in the evolutionary history of currently classified HBV genotypes .

Epidemiological investigations have demonstrated a high prevalence (42.6%) of HBV infection in orangutan populations, with even wild orangutans showing HBV surface antigen positivity, indicating that these viruses occur naturally rather than representing human-to-orangutan transmission during captivity . This natural occurrence has significant implications for understanding the evolutionary trajectory of hepadnaviruses across primate species.

What is the structural composition of the OHV envelope proteins, particularly the Large (L) protein?

OHV envelope proteins share structural similarities with human HBV envelope proteins but contain multiple unique amino acid residues that distinguish them from human HBV variants. The viral envelope consists of three proteins: Large (L), Medium (M), and Small (S), with the L protein playing a crucial role in virion assembly and morphogenesis .

The L protein contains pre-S regions that are essential for virus assembly and host receptor binding. When examining the pre-S amino acid sequences of OHV isolates compared to human HBV genotypes, three unique amino acid residues (Thr-85, Val/Ser-91, and Leu/Phe-166) have been identified . Additionally, the small S protein component contains six unique residues (Ser/Leu-5, Leu-56, Val-118, Ser-127, Pro-129, and Ala-224) . These distinct amino acid signatures are crucial for classifying OHV as a separate viral entity and understanding its specific interactions with host cells.

How does OHV infection progress in orangutans and what clinical manifestations have been observed?

Based on serological investigations, OHV infection appears to follow patterns similar to human HBV infection progression, though with potentially different clinical outcomes. In one documented case, an orangutan named Abau acquired infection while at a rehabilitation center. Initially testing negative, the animal later developed detectable HBsAg in serum. Approximately two months later, the orangutan developed HBcAb and HBsAb antibodies, coinciding with clearance of HBsAg and negative PCR results . This timeline suggests an infection progression pattern comparable to acute HBV infection in humans.

What techniques are employed for expression and characterization of recombinant OHV Large envelope protein?

Recombinant expression of OHV Large envelope protein typically employs molecular cloning techniques using oligonucleotide primers designed to bind to conserved sequences among HBV strains. For amplification of the entire S gene, which encodes the envelope proteins, researchers have utilized primers such as hepB-SF1 and BR to generate 1,359-bp DNA fragments . The amplification protocol typically involves PCR performed in a 50-μl volume, using 10 μl of DNA template, with specific buffer conditions (10 mM Tris-HCl, pH 8.3, 50 mM KCl, 0.01% bovine serum albumin, 2.5 mM MgCl2) .

For protein characterization, researchers employ various approaches:

  • Sequence analysis: Deduced amino acid sequences are aligned with corresponding regions of human HBV genotypes to identify unique residues.

  • Serological typing: Based on specific amino acid residues in the small S protein, particularly positions 122 and 160, where OHV contains arginine (R) residues typical of ayw or ayr serotypes .

  • Immunological detection: Using antibodies specific for particular regions, such as those targeting the C-terminal or N-terminal sequences of core proteins .

  • SDS-PAGE analysis: For confirming protein size and integrity, ensuring no truncation or degradation has occurred .

How do recombination events contribute to OHV evolution and what methods reveal these patterns?

Recombination plays a significant role in the evolution of hepadnaviruses, including OHV. Large-scale data retrieval and automated phylogenetic analysis, particularly TreeOrder scanning of complete genome sequences, have been instrumental in detecting recombination events . This method involves generating phylogenetic trees from sequential fragments across the genome and identifying violations of phylogeny between trees as evidence of recombination.

Research has detected numerous phylogenetically independent potential recombinants with different genotype combinations or distinct breakpoints among hepadnaviruses . Instances of intergenotype recombination have been observed in all human and ape HBV variants, including evidence for gibbon/genotype C recombinants among HBV variants from Vietnam .

Favored positions for both inter- and intragenotype recombination frequently match positions of phylogenetic reorganization between human and ape genotypes, such as the end of the surface gene and the core gene . These findings suggest that recombination events have significantly contributed to the diversity observed in current HBV genotypes and potentially influenced their epidemiological distribution and pathogenicity.

What role does the Large envelope protein play in OHV virion assembly and secretion?

The Large envelope protein serves critical functions in virion assembly and secretion, as demonstrated through various experimental approaches using cultured hepatoma cells transfected with mutant HBV genomes bearing lesions in envelope coding regions . Research has established that:

  • Nucleocapsids are not released from cells without expression of envelope proteins, indicating an active role for these proteins in viral morphogenesis .

  • Both S and L proteins are necessary for virion production, while the M protein appears dispensable .

  • Interestingly, L protein over-expression inhibits virion release, mirroring its inhibitory effect on the release of subviral hepatitis B surface antigen (HBsAg) particles .

  • Mutant L proteins that no longer retain HBsAg particles in the endoplasmic reticulum still permit virion formation, suggesting that ER retention is not required for viral budding .

These findings underscore the complex regulatory role of the L protein in balancing virion assembly and secretion, with important implications for understanding OHV replication strategies.

What models explain the paradoxical observations regarding genome content in secreted OHV virions?

Recent research has challenged traditional models of hepadnavirus morphogenesis by demonstrating that the vast majority of HBV virions (over 90%) contain no DNA at all, indicating that nucleocapsids (NCs) with no genome can be enveloped and secreted as empty virions . This challenges the prevailing model positing that double-stranded (DS) DNA accumulation during reverse transcription triggers structural changes in maturing NCs to signal envelopment and secretion.

To reconcile the seemingly contradictory observations that virion formation selects stringently for DS DNA over single-stranded (SS) nucleic acid, yet empty virions are readily secreted, researchers have proposed a "single strand blocking" model . In this negative signal model:

  • The presence of SS DNA or pregenomic RNA (pgRNA) in immature NCs actively prevents their envelopment.

  • These immature genomes trigger a signal that negatively regulates NC envelopment.

  • Only when the genome matures to DS DNA or is entirely absent can this blocking be overcome.

This model provides a mechanistic explanation for both the selective secretion of virions containing DS DNA and the observed secretion of empty virions, with significant implications for understanding OHV lifecycle regulation .

What experimental systems are optimal for studying OHV envelope protein functions?

Several experimental systems have proven valuable for investigating OHV envelope protein functions:

  • Cell culture transfection models using hepatoma cell lines transfected with HBV/OHV genomes containing specific mutations in envelope protein coding regions .

  • Density gradient centrifugation to separate different virion populations, particularly distinguishing between "light" (potentially empty) and "heavy" (genome-containing) particles .

  • Electron microscopy to visualize virion morphology and confirm the presence/absence of nucleic acid content .

  • Endogenous polymerase activity assays to reflect DNA synthesis capability by the virion reverse transcriptase using endogenous DNA templates .

  • PCR-based detection systems using primers specific to conserved regions among hepadnavirus genomes .

When designing experiments to study OHV envelope proteins, researchers should consider the following methodological approaches:

  • Site-directed mutagenesis to create specific amino acid substitutions in envelope proteins for structure-function analyses.

  • Immunoprecipitation assays using antibodies against different domains of the envelope proteins.

  • Fluorescence microscopy with tagged envelope proteins to track intracellular localization and trafficking.

  • Co-expression systems to study interactions between envelope proteins and other viral components.

How can researchers differentiate between OHV and human HBV in experimental samples?

Differentiating between OHV and human HBV in experimental or clinical samples requires multi-faceted approaches:

  • Genomic sequencing: Focusing on regions with known sequence divergence, particularly the pre-S regions where OHV contains three unique amino acid residues (Thr-85, Val/Ser-91, and Leu/Phe-166) and the small S protein with six unique residues (Ser/Leu-5, Leu-56, Val-118, Ser-127, Pro-129, and Ala-224) .

  • Serological typing: Although OHV belongs to ayw or ayr serotypes based on arginine (R) residues at position 122 and arginine (R) or lysine (K) at position 160, genotype subtyping (w1-w4) is not possible due to a unique serine (S) residue at position 127, providing a distinctive marker .

  • Phylogenetic analysis: TreeOrder scanning and other phylogenetic methods can place isolates within evolutionary contexts, distinguishing OHV clusters from human HBV genotypes .

  • PCR-based approaches: Using primers specifically designed to amplify conserved regions while detecting variant-specific sequences through subsequent restriction enzyme analysis or sequencing.

What implications does the high prevalence of empty virions have for research methodology?

The discovery that over 90% of HBV virions may contain no DNA at all has profound implications for research methodologies:

  • Quantification approaches: Traditional methods quantifying viral DNA may significantly underestimate total virion production. Researchers should employ techniques that detect both DNA-containing and empty virions, such as:

    • Protein-based assays for envelope or capsid proteins

    • Electron microscopy with gold-labeled antibodies

    • Density gradient separation followed by protein quantification

  • Functional studies: When investigating viral entry, researchers must consider that the majority of virions may be non-infectious empty particles, potentially acting as decoys or modulators of immune responses.

  • Purification strategies: Methods relying solely on nucleic acid content will exclude the majority of virions, creating potentially biased samples. Alternative approaches include:

    • Immunoaffinity purification targeting envelope proteins

    • Size-exclusion chromatography

    • Density gradient ultracentrifugation with subsequent protein analysis

  • Experimental design: Studies examining viral production should distinguish between genome replication and virion secretion as potentially separate processes, as genome packaging appears not to be required for virion secretion .

What aspects of OHV Large envelope protein research remain unexplored?

Despite advances in understanding OHV envelope proteins, several critical research areas remain to be addressed:

  • Structural biology: High-resolution crystal structures of OHV Large envelope protein remain unavailable, limiting our understanding of how its unique amino acid residues influence protein folding and function.

  • Host-virus interactions: The specific interactions between OHV envelope proteins and orangutan hepatocyte receptors are poorly characterized, particularly how they might differ from human HBV-receptor interactions.

  • Immunological studies: How the orangutan immune system recognizes and responds to OHV envelope proteins, especially in natural infections that appear to cause limited liver pathology .

  • Functional significance of empty virions: The biological role and evolutionary advantage of producing predominantly empty virions remain poorly understood and warrant investigation .

  • Regulatory mechanisms: How expression levels of the Large envelope protein are regulated to balance optimal virion production, given that over-expression inhibits virion release .

How might methodological advances improve our understanding of OHV envelope proteins?

Emerging technologies and methodological approaches offer new opportunities for advancing OHV envelope protein research:

  • Cryo-electron microscopy for high-resolution structural analysis of intact virions, potentially revealing conformational differences between empty and DNA-containing particles.

  • Single-molecule studies to examine real-time interactions between envelope proteins and cellular components during viral assembly and budding.

  • CRISPR/Cas9-mediated genome editing of orangutan cell lines to investigate host factors influencing OHV envelope protein function.

  • Advanced mass spectrometry techniques for comprehensive post-translational modification profiling of envelope proteins in different virion populations.

  • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics to understand the cellular impact of OHV envelope protein expression.

  • Organoid culture systems derived from orangutan liver tissue to provide more physiologically relevant experimental platforms for studying OHV replication and morphogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.