Recombinant Oreochromis mossambicus D (1)-like dopamine receptor

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
D(1-like dopamine receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica)
Target Protein Sequence
MEIFTTTRGTSAGPEPAPGGHGGTDSPRTSDLSLRALTGCVLCILIVSTLLGNALVCAAV IKFRHLRSKVTNAFVISLAVSDLFVAVLVMPWRAVSEVAGVWLFGAFCDTWVAFDIMCST ASILHLCIISMDRYWAISSPFRYERRMTPRFGCVMIGVAWTLSVLISFIPVQLNWHARGR ERTDPGDCNASLNRTYAISSSLISFYIPVLIMVGTYTRIFRIGRTQIRRISSLERAAPRA TRGPALCDEESSLKTSFRRETKVLKTLSVIMGVFVFCWLPFFVLNCMVPFCRLEPAAAPC VSDTTFSVFVWFGWANSSLNPVIYAFNADFRKAFSTILGCSRYCRTSAVEAVDFSNELAS YHHDTTLQKEASSRGNSRGGPYQFAL
Uniprot No.

Target Background

Function
This receptor is one of five dopamine receptor subtypes (D1 to D5). Its activity is mediated by G proteins that activate adenylyl cyclase.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are D(1)-like dopamine receptors and how do they differ from D(2)-like receptors?

D(1)-like dopamine receptors represent one of the two major families of G protein-coupled receptors that respond to the neurotransmitter dopamine. This family includes the D1 and D5 receptor subtypes in mammals, with homologous receptors identified in teleost fish including Oreochromis mossambicus. The key differences between D(1)-like and D(2)-like receptors include:

  • Signaling pathway: D(1)-like receptors primarily couple to stimulatory G proteins (Gαs), activating adenylyl cyclase and increasing intracellular cAMP levels, whereas D(2)-like receptors couple to inhibitory G proteins (Gαi/o), inhibiting adenylyl cyclase .

  • Binding characteristics: D(1)-like receptors show markedly different responses to endogenous dopamine compared to D(2)-like receptors. Studies have demonstrated that D(1)-like receptors exhibit low occupancy by endogenous dopamine under physiological conditions, making them less suitable for measuring changes in endogenous dopamine levels .

  • Pharmacological profile: D(1)-like receptors have distinct ligand selectivity, with compounds like SCH 23390 and NNC 112 binding specifically to these receptors, as utilized in PET imaging studies .

  • Anatomical distribution: While both receptor families are expressed in the brain, their regional distribution patterns differ, with specific expression patterns in the preoptic area of fish that vary according to reproductive status .

What is known about D(1)-like dopamine receptor expression in Oreochromis mossambicus?

In Oreochromis mossambicus, D(1)-like dopamine receptor expression exhibits distinctive patterns related to reproductive physiology:

  • Anatomical localization: D(1)-like dopamine receptors are prominently expressed in the preoptic area (POA) and nucleus preopticus (NPO) of the brain .

  • Developmental expression: Research indicates that receptor expression varies significantly across reproductive phases, with intensity correlating to reproductive status .

  • Functional importance: These receptors appear to mediate stress-induced suppression of reproduction, suggesting a critical role in neuroendocrine regulation .

  • Visualization methods: Tyrosine hydroxylase (TH) immunoreactivity is commonly used as a marker for dopaminergic neurons that interact with these receptors, showing intense staining during the previtellogenic phase and weak immunoreactivity during vitellogenic and prespawning phases .

Why are cichlid fish models useful for studying dopamine receptor biology?

Cichlid fish models, particularly Oreochromis mossambicus, offer several advantages for dopamine receptor research:

  • Evolutionary perspective: They provide insights into the conservation and divergence of dopaminergic systems across vertebrate evolution.

  • Reproductive physiology: Their distinct reproductive cycles offer natural models for studying hormone-neurotransmitter interactions under varying physiological states .

  • Stress response: These fish exhibit clear stress-related reproductive suppression mediated by dopaminergic signaling, making them valuable for studying the intersection of stress and reproduction .

  • Neuroanatomical accessibility: The relatively simpler neural organization allows for clearer identification of specific nuclei and pathways involved in dopaminergic signaling.

  • Translational relevance: Despite evolutionary distance, core aspects of dopaminergic signaling remain conserved, allowing for potential insights into human neurological and psychiatric conditions.

How does the binding behavior of D(1)-like dopamine receptors in Oreochromis mossambicus compare with mammalian models?

The binding characteristics of D(1)-like dopamine receptors in Oreochromis mossambicus show both similarities and distinctions compared to mammalian models:

  • Receptor occupancy: While mammalian studies indicate that D(1)-like dopamine receptors have low occupancy by endogenous dopamine under physiological conditions, similar properties appear to exist in fish models . This suggests evolutionary conservation of this fundamental receptor property.

  • Response to pharmacological manipulation: In mammalian studies, D(1)-like receptor binding shows minimal response to amphetamine-induced dopamine release (-14% to +6% change in binding potential), unlike the pronounced effects seen with D(2)-like receptors . Limited evidence suggests similar differential sensitivity may exist in fish models.

  • Affinity parameters: The apparent affinity (KD(app)) of D(1)-like receptors in mammals remains relatively stable even after dopamine depletion, unlike changes observed in D(2)-like receptors . Comparative data for fish is limited but represents a critical research direction.

  • Regional variability: The preoptic area in fish shows reproductive stage-dependent expression of D(1)-like receptors, suggesting specialized regulatory mechanisms not fully characterized in mammalian systems .

What are the methodological challenges in producing functional recombinant D(1)-like dopamine receptors from Oreochromis mossambicus?

Researchers face several technical challenges when working with recombinant D(1)-like dopamine receptors from Oreochromis mossambicus:

  • Protein folding and membrane insertion: As G protein-coupled receptors, D(1)-like receptors contain seven transmembrane domains that must fold correctly to maintain functionality. Expression systems must provide appropriate cellular machinery for correct folding and membrane insertion.

  • Post-translational modifications: Fish dopamine receptors may require specific glycosylation patterns or other modifications that differ from mammalian systems, potentially necessitating specialized expression systems.

  • Functional assays: Verification of receptor functionality requires development of appropriate binding assays or second messenger response measurements calibrated specifically for the fish receptor.

  • Ligand selectivity: The pharmacological profile of fish D(1)-like receptors may differ from mammalian counterparts, requiring careful characterization with a range of agonists and antagonists.

  • Stability considerations: Maintaining receptor stability during purification and subsequent experiments often requires optimization of detergents, buffers, and storage conditions specific to the fish receptor.

How do age-related changes in D(1) receptor expression in fish compare to mammals, and what are the implications for comparative neuropharmacology?

Age-related changes in dopamine receptor expression represent an important area of comparative research:

What are the optimal expression systems for producing recombinant Oreochromis mossambicus D(1)-like dopamine receptors?

The choice of expression system for recombinant fish dopamine receptors requires careful consideration:

  • Mammalian cell lines (HEK293, CHO cells): These systems provide mammalian-type post-translational modifications and membrane composition that may support fish receptor functionality. Transfection optimization with fish-specific codon usage may improve expression levels.

  • Insect cell systems (Sf9, Hi5): The baculovirus expression system offers advantages for G protein-coupled receptors, potentially providing higher expression levels than mammalian cells while maintaining essential post-translational modifications.

  • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae): These can produce large quantities of receptor protein, though glycosylation patterns differ from vertebrates and may affect receptor functionality.

  • Cell-free systems: These allow rapid production but may lack necessary post-translational modifications and membrane environments for proper folding.

Each system requires optimization of expression conditions, including temperature, induction parameters, and harvesting protocols specific to the fish receptor. Validation of receptor functionality through ligand binding assays or signaling readouts is essential regardless of the chosen expression system.

What techniques are most effective for studying D(1)-like dopamine receptor binding properties in Oreochromis mossambicus?

Several complementary techniques can effectively characterize D(1)-like dopamine receptor binding:

  • Radioligand binding assays: Using selective radioligands such as [³H]SCH 23390 for saturation binding, competition binding, and kinetic studies provides fundamental binding parameters (Kd, Bmax, Ki values).

  • PET imaging: As demonstrated in mammalian studies, PET with radioligands such as [¹¹C]SCH 23390 or [¹¹C]NNC 112 allows for in vivo assessment of receptor binding potential, though modification for fish studies would require specialized equipment .

  • Scatchard analysis: This approach, using varying concentrations of radioligand, enables determination of receptor density (Bmax) and apparent affinity (KD(app)), as employed in mammalian studies .

  • Fluorescence-based methods: FRET or BRET-based assays can assess receptor conformational changes upon ligand binding and receptor-G protein interactions in real-time.

  • Surface plasmon resonance: This technique can measure binding kinetics of purified recombinant receptors with various ligands, providing detailed binding parameters without radioactivity.

For meaningful interpretation, binding studies should include appropriate controls and account for non-specific binding, particularly in fish tissue where less is known about potential binding interferents.

What immunohistochemical approaches are most suitable for visualizing D(1)-like dopamine receptor expression patterns in Oreochromis mossambicus brain tissue?

Effective immunohistochemical characterization of D(1)-like receptors in fish brain requires:

  • Antibody selection: While commercial antibodies against mammalian D1 receptors may cross-react with fish receptors, validation is critical. Custom antibodies raised against fish-specific epitopes may provide superior specificity.

  • Fixation protocols: Optimal fixation methods (typically 4% paraformaldehyde) must preserve receptor antigenicity while maintaining tissue structure. Perfusion fixation generally yields better results than immersion fixation.

  • Antigen retrieval: Heat-induced or enzymatic antigen retrieval methods may improve antibody access to epitopes, though protocols must be optimized specifically for fish tissue.

  • Double-labeling approaches: Combining D1 receptor labeling with markers for specific cell types (such as tyrosine hydroxylase for dopaminergic neurons) provides valuable information about receptor localization .

  • Visualization systems: Fluorescence-based detection with appropriate controls for autofluorescence (common in fish tissue) or enzyme-based detection systems (DAB) can be employed depending on experimental goals.

  • Quantification methods: Standardized approaches to quantify receptor immunoreactivity, such as optical density measurements, cell counting, or intensity analysis, should be established with appropriate statistical validation .

How does D(1)-like dopamine receptor expression change during different reproductive stages in Oreochromis mossambicus?

Research indicates that D(1)-like dopamine receptor expression in Oreochromis mossambicus varies significantly across reproductive stages:

Reproductive StageD(1)-like Receptor Expression in POA/NPOTH ImmunoreactivityLH Immunoreactivity in PPDOvarian Development
PrevitellogenicHighIntense stainingLowEarly stage follicles
VitellogenicModerateWeak stainingModerateDeveloping follicles
PrespawningLowWeak stainingDarkly stainedFully ripened (stage V)

This pattern suggests an inverse relationship between D(1)-like receptor expression and reproductive maturation, consistent with the inhibitory role of dopamine on reproduction in teleost fish . The decrease in receptor expression as the fish approaches spawning may represent a reduction in dopaminergic inhibition, allowing for appropriate hormonal surges necessary for ovulation and spawning behavior.

How do pharmacological manipulations of D(1)-like dopamine receptors affect reproductive parameters in Oreochromis mossambicus?

Pharmacological studies have provided insights into the functional role of D(1)-like dopamine receptors in reproductive physiology:

Pharmacological AgentReceptor TargetEffect on D1R ExpressionEffect on Reproductive ParametersProposed Mechanism
Dopamine agonistsD(1)-likeDownregulationInhibition of LH release, Delayed ovulationActivation of inhibitory dopaminergic pathways
D1 antagonistsD(1)-likePotential upregulationEnhanced LH release, Advancement of ovulationBlockade of inhibitory dopaminergic tone
Stress exposureIndirect effectEnhanced expressionSuppressed reproductionStress-induced activation of dopaminergic neurons

These findings highlight the inhibitory role of D(1)-like receptor activation on reproduction in this species, suggesting that stress-induced reproductive suppression may be mediated, at least in part, through enhanced dopaminergic signaling at D(1)-like receptors .

What structural and functional differences exist between recombinant D(1)-like dopamine receptors from Oreochromis mossambicus and their mammalian counterparts?

Comparative analysis reveals several key differences between fish and mammalian D(1)-like receptors:

FeatureOreochromis mossambicus D(1)-likeMammalian D1 ReceptorFunctional Implications
Amino acid sequence75-85% homology to mammalian D1Reference sequencePotential differences in ligand binding pocket and G-protein interaction domains
Pharmacological profileResponsive to SCH 23390 but with different affinityHigh affinity for SCH 23390Species-specific pharmacological tools needed
Temperature sensitivityFunctional at lower temperatures (20-30°C)Optimal at 37°CAdaptation to poikilothermic physiology
G-protein couplingPrimarily Gαs but with potential coupling to other G proteinsPrimarily GαsPossible diversity in signaling outcomes
Expression regulationStrongly regulated by reproductive statusLess dramatic reproductive regulationSpecialized role in reproduction in fish

These differences reflect evolutionary adaptations to the fish's environmental and physiological requirements. The specialized regulation of receptor expression in relation to reproductive state suggests a more prominent role for dopaminergic signaling in reproductive control in fish compared to mammals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.