Recombinant Organic solute transporter alpha-like protein C01B12.4 (C01B12.4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
osta-1; C01B12.4; Organic solute transporter alpha-like protein 1; Solute carrier family 51 subunit alpha homolog C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
osta-1
Target Protein Sequence
MEIVKTIIPHNRSYIEPPIPSATEWLANMSVMHVSCLTIACVFVAITFLSSFFHLFFVLK YVSNERIRNDMYALIFMFPITTFASLVGMFIPRAAIFLYAVSLVYFMFTLFIMVTLLFNI FGGRQEMSAYLLQRNIRVNFTVPPLCFFKFLPTVESTDQNLRRIEWLVFQTPIIRTLLEL VSVVVSMEQEGRRESVWFVFSQLMALLSMCIAFYGCYVMVPLGREKHAPYRFDFLFRTCD IAQCIYTIQKFVFEFAAAVGLITSDRYLPAAAKALWWASFMCTWEMMLLSALCSYCLRPA KCKFFDLYPGNDMPALSARDGSNSRVPSFSRRLSIEYEPRIAGVMLEPPSRSSLSITPRD KIEDPTTVSYFADNFDSLSQIQGQ
Uniprot No.

Target Background

Function
Probable transporter.
Database Links

KEGG: cel:CELE_C01B12.4

STRING: 6239.C01B12.4

UniGene: Cel.16018

Protein Families
OST-alpha family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Organic Solute Transporter Alpha-Like Protein C01B12.4 (OSTA-1)?

OSTA-1 (C01B12.4) is a transmembrane protein encoded by the osta-1 gene in Caenorhabditis elegans. It belongs to the conserved family of organic solute transporter alpha proteins, which are implicated in membrane trafficking and solute transport. The full-length protein consists of 384 amino acids and contains five predicted transmembrane helices based on topology analysis . OSTA-1 is one of four family members in C. elegans, with OSTA-2 (C18A3.4) and OSTA-3 (W01D2.5) being closely related homologs . The protein has been identified as a critical regulator of ciliary architecture via the regulation of cilia-destined trafficking pathways .

Where is OSTA-1 expressed in C. elegans and how can its localization be visualized?

OSTA-1 is expressed in ciliated sensory neurons in C. elegans, particularly in the head amphid sensory organs. Its expression and localization can be studied using fluorescent reporter constructs such as osta-1p::gfp fusion genes containing 2.0 kb of osta-1 upstream regulatory sequences . OSTA-1 localizes to a specific ciliary compartment that houses trafficking proteins and is associated with transport vesicles in sensory neuron dendrites . For detailed visualization studies, researchers typically use the osta-1p::osta-1::gfp construct generated by amplifying osta-1 genomic sequences including 2.0 kb upstream, the entire coding region, and 0.3 kb of downstream sequence .

What is the primary function of OSTA-1 in sensory neurons?

OSTA-1 functions as a regulator of intracellular trafficking pathways that transport ciliary membrane and protein components in sensory neurons. It plays a crucial role in shaping the morphology and protein composition of sensory cilia in C. elegans . Specifically, OSTA-1 regulates both retrograde and anterograde flux of the endosome-associated RAB-5 small GTPase and is associated with transport vesicles . This regulation of trafficking pathways contributes to the maintenance of proper ciliary architecture and function. Genetic studies have shown that OSTA-1 interacts with sensory signaling, exocytic, and endocytic proteins to regulate ciliary architecture, suggesting it serves as a central component in the trafficking network that determines cilia structure and function .

How does OSTA-1 regulate ciliary morphology and what cellular mechanisms are involved?

OSTA-1 regulates ciliary morphology by controlling trafficking pathways that shape ciliary membrane volume, branch length, and complexity. Mutations in osta-1 result in altered ciliary membrane volume and branch length, as well as defects in localization of a subset of ciliary transmembrane proteins in different sensory cilia types . OSTA-1 appears to be particularly important for maintaining the specialized morphology of sensory cilia, such as those in the AWB olfactory neurons.

The cellular mechanisms involved include:

  • Association with transport vesicles in the ciliary compartment

  • Regulation of RAB-5 small GTPase trafficking along dendrites

  • Interaction with sensory signaling pathways that modulate cilia morphology

  • Regulation of both retrograde (cell body to cilium) and anterograde (cilium to cell body) transport

These mechanisms together contribute to the dynamic remodeling of ciliary architecture through multiple inputs, allowing for specialized morphologies essential for neuronal functions .

What phenotypes are observed in osta-1 mutants and how are they characterized?

Mutations in osta-1 result in various phenotypes that can be characterized through specific assays:

  • Progressive cell type-specific dye-filling defects, particularly in ASK neurons

  • Altered ciliary membrane volume, branch length, and complexity

  • Defects in localization of specific ciliary transmembrane proteins

  • Punctate dye accumulation in filled dendrites

The dye-filling phenotypes show developmental and neuronal specificity. The ASK neurons exhibit a partially age-dependent dye uptake defect in osta-1 mutants, while 80-100% of ADL, ASH, and ASJ neurons retain the ability to fill with dye at all developmental stages . These observations suggest that osta-1 is required to maintain the morphological integrity of specific sensory neurons, particularly ASK amphid sensory neurons. Researchers can quantify these phenotypes using standardized dye-filling protocols with lipophilic dyes such as DiI .

How can researchers express and purify recombinant OSTA-1 protein?

Recombinant OSTA-1 can be expressed in E. coli as a full-length protein (1-384 aa) fused to an N-terminal His tag . The detailed protocol involves:

  • Cloning the full-length osta-1 cDNA into an appropriate expression vector with an N-terminal His tag

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the recombinant protein using affinity chromatography

  • Confirming protein identity and purity using SDS-PAGE (purity should exceed 90%)

  • Lyophilizing the purified protein for long-term storage

The resulting recombinant protein typically contains the complete 384 amino acid sequence of OSTA-1 with an N-terminal His tag to facilitate purification . This approach allows researchers to obtain sufficient quantities of the protein for biochemical and structural studies.

What are the optimal storage and reconstitution conditions for recombinant OSTA-1?

For optimal results with recombinant OSTA-1, researchers should follow these storage and reconstitution guidelines:

Storage conditions:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage at -20°C/-80°C

  • The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Repeated freezing and thawing should be avoided as it may lead to protein denaturation and loss of activity . These storage and reconstitution conditions are critical for maintaining protein stability and activity for downstream applications.

What genetic tools are available for studying osta-1 in C. elegans?

Several genetic tools are available for studying osta-1 in C. elegans:

  • Multiple osta-1 mutant alleles have been characterized, including:

    • osta-1(tm5255)

    • osta-1(ttTi4182)

    • Additional alleles generated by the NEMAGENETAG Project

  • Transgenic reporter constructs:

    • osta-1p::gfp - contains 2.0 kb of osta-1 upstream regulatory sequences

    • osta-1p::osta-1::gfp - includes 2.0 kb upstream, entire coding region, and 0.3 kb downstream sequence

  • Molecular tools:

    • osta-1 cDNAs obtained by reverse transcription from wild-type RNA

    • PCR fusion techniques for generating fluorescent protein fusions

    • Primer sequences for amplification and sequencing (available in supplementary materials)

These tools allow researchers to investigate osta-1 function through genetic manipulation, expression analysis, and phenotypic characterization in vivo.

What assays can be used to evaluate OSTA-1 function in vivo?

Several assays can be used to evaluate OSTA-1 function in C. elegans:

  • Dye-filling assays: Using lipophilic dyes like DiI to assess the integrity and morphology of sensory neurons. This approach reveals defects in amphid sensory neurons in osta-1 mutants, particularly in a progressive, age-dependent manner in ASK neurons .

  • Behavioral assays:

    • Avoidance of a point source of repellents like 2-nonanone (mediated by AWB neurons)

    • Avoidance of 60% glycerol (mediated by ASH neurons)

    • Entry into the alternative dauer stage (mediated by ASK and ASI neurons)

  • Microscopy techniques:

    • Fluorescence microscopy to visualize reporter expression patterns

    • Spinning disk confocal microscopy to examine ciliary morphology in detail

  • Genetic epistasis experiments: Combining osta-1 mutations with mutations in sensory signaling, exocytic, and endocytic proteins to understand genetic interactions and pathway relationships .

These assays collectively provide a comprehensive assessment of OSTA-1 function in maintaining ciliary morphology and sensory neuron function.

How does OSTA-1 interact with RAB-5 and other trafficking components?

OSTA-1 regulates both retrograde and anterograde flux of the endosome-associated RAB-5 small GTPase in ciliated sensory neuron dendrites . This interaction represents a crucial mechanism by which OSTA-1 influences ciliary morphology and function. Advanced research approaches to study this interaction include:

  • Co-localization studies with fluorescently tagged OSTA-1 and RAB-5 using constructs such as:

    • osta-1p::osta-1::gfp

    • rab-5 cDNA constructs obtained by reverse transcription from wild-type RNA

  • Live imaging to track the movement of RAB-5-positive vesicles in wild-type versus osta-1 mutant backgrounds, which can reveal differences in trafficking dynamics.

  • Genetic epistasis experiments combining osta-1 mutations with mutations in rab-5 or rab-8, which has been employed to understand how these proteins function together in ciliary trafficking pathways .

  • Analysis of RAB-5 localization patterns in osta-1 mutants compared to wild-type animals to identify specific trafficking defects.

This multi-faceted approach can provide insights into how OSTA-1 regulates endosomal trafficking to shape ciliary architecture.

What experimental considerations are critical when comparing wild-type and osta-1 mutant phenotypes?

When comparing wild-type and osta-1 mutant phenotypes, researchers should consider several critical factors:

  • Age-dependency of phenotypes: The dye-filling defects in osta-1 mutants show partial age-dependency, particularly in ASK neurons . Therefore, researchers must carefully control the developmental stage at which phenotypes are assessed.

  • Neuron-specific effects: Different neurons show varying sensitivity to osta-1 mutation (e.g., ASK shows strong defects while ADL, ASH, and ASJ are less affected) . Analysis should include multiple neuron types to comprehensively assess phenotypes.

  • Experimental variables: As highlighted in research on C. elegans stress responses, factors such as:

    • Animal age at exposure

    • Culture type (liquid vs. solid)

    • Bacterial food source

    • Environmental temperature
      can significantly impact experimental outcomes .

  • Genetic background: Ensure that mutant strains are properly outcrossed (at least three times) to remove background mutations that might confound results .

  • Quantification methods: Develop standardized scoring systems for phenotypic analysis to enable statistical comparison between genotypes.

Controlling these variables is essential for generating reproducible results when studying osta-1 function.

How can researchers investigate the evolutionary conservation of OSTA-1 function across species?

OSTA-1 belongs to a conserved family of organic solute transporter alpha proteins found across eukaryotes. Mammalian homologs have been implicated in membrane trafficking and solute transport in secretory cells, although their specific role in regulating cilia structure remains less characterized . To investigate evolutionary conservation:

  • Sequence analysis: Compare OSTA-1 with mammalian homologs (Organic solute transporter alpha proteins) to identify conserved domains that might mediate trafficking functions.

  • Cross-species rescue experiments: Express mammalian homologs in osta-1 mutant C. elegans to test for functional conservation through phenotypic rescue.

  • Comparative localization studies: Determine whether mammalian homologs localize to similar cellular compartments as OSTA-1 in ciliated cells.

  • Functional assays in mammalian systems: Evaluate whether knockdown of mammalian homologs affects ciliary morphology or trafficking in mammalian ciliated cells.

  • Domain-swapping experiments: Create chimeric proteins combining domains from C. elegans OSTA-1 and mammalian homologs to identify functionally conserved regions.

These approaches can reveal the extent to which OSTA-1's role in ciliary morphology regulation is conserved across evolution and potentially identify novel functions in higher organisms.

What experimental variables might affect studies involving OSTA-1 and how can they be controlled?

Based on research in C. elegans, several experimental variables can significantly impact outcomes in OSTA-1 studies:

VariablePotential ImpactControl Strategy
Age of wormsOSTA-1 phenotypes show age-dependency Synchronize populations and analyze at defined developmental stages
Culture typeLiquid vs. solid media can affect stress responses and phenotypes Maintain consistent culture conditions across experiments
Bacterial food sourceDifferent E. coli strains may alter phenotypic outcomes Use consistent bacterial strains (e.g., OP50)
Environmental temperatureCan affect protein expression and trafficking Maintain strict temperature control (typically 20°C)
Genetic backgroundBackground mutations can confound resultsUse properly outcrossed strains (minimum 3x)
Imaging parametersInconsistent settings can affect quantificationStandardize microscopy settings across samples
Timing of analysesCritical for progressive phenotypesDefine and adhere to specific timepoints for analyses

Researchers should explicitly report these variables in publications to ensure reproducibility. For example, when studying dye-filling defects in osta-1 mutants, it's critical to specify the age of animals examined since the phenotype progressively worsens with age in certain neurons .

What are common challenges in working with recombinant OSTA-1 protein and how can they be addressed?

As a transmembrane protein, OSTA-1 presents several technical challenges when produced as a recombinant protein:

  • Protein solubility and stability:

    • Challenge: Transmembrane proteins often aggregate or misfold when expressed recombinantly

    • Solution: Use optimized buffer conditions (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

  • Proper reconstitution:

    • Challenge: Lyophilized protein may not fully reconstitute or may lose activity

    • Solution: Follow specific reconstitution protocols, reconstituting in deionized sterile water to 0.1-1.0 mg/mL and adding glycerol for stability

  • Storage stability:

    • Challenge: Repeated freeze-thaw cycles can denature the protein

    • Solution: Aliquot the protein and store at -20°C/-80°C; keep working aliquots at 4°C for up to one week

  • Functional verification:

    • Challenge: Confirming that recombinant protein retains native activity

    • Solution: Develop activity assays based on known functions or binding partners

  • Batch-to-batch variability:

    • Challenge: Different preparations may have varying levels of activity

    • Solution: Implement quality control measures such as SDS-PAGE to ensure >90% purity

Addressing these challenges requires careful attention to protein handling protocols and quality control measures to ensure consistent experimental results.

How can researchers distinguish between direct and indirect effects of OSTA-1 on ciliary morphology?

Distinguishing between direct and indirect effects of OSTA-1 on ciliary morphology requires sophisticated experimental approaches:

  • Cell-specific rescue experiments:

    • Express OSTA-1 only in specific neurons using cell-type-specific promoters

    • Assess whether local expression is sufficient to rescue phenotypes

    • This approach can determine where OSTA-1 functions autonomously

  • Temporal control of OSTA-1 expression:

    • Use heat-shock or drug-inducible promoters to express OSTA-1 at different developmental stages

    • Determine whether acute expression can rescue established defects

    • This distinguishes developmental versus maintenance roles

  • Structure-function analyses:

    • Generate mutations in specific domains of OSTA-1

    • Map which regions are required for different aspects of function

    • Correlate domain function with specific phenotypes

  • Trafficking assays with direct visualization:

    • Track labeled RAB-5 movement in wild-type versus osta-1 mutants

    • Quantify trafficking defects in terms of velocity, directionality, and frequency

    • This approach can establish direct trafficking roles for OSTA-1

  • Proximity labeling approaches:

    • Identify proteins that directly interact with OSTA-1 in relevant cellular compartments

    • Distinguish between direct binding partners and downstream effectors

These methodological approaches, while technically challenging, provide the resolution necessary to delineate the direct mechanisms by which OSTA-1 influences ciliary morphology and protein localization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.