Recombinant Organic solute transporter alpha-like protein C18A3.4 (C18A3.4)

Shipped with Ice Packs
In Stock

Description

Overview of Organic Solute Transporters (OSTα/β)

OSTα (encoded by SLC51A) and OSTβ (encoded by SLC51B) form a heteromeric transporter critical for bile acid and steroid transport across basolateral membranes in enterocytes, hepatocytes, and renal cells . Key features include:

  • Structure: OSTα is a 340-amino-acid polytopic membrane protein with seven transmembrane domains, while OSTβ is a 128-amino-acid single-pass membrane protein .

  • Function: The OSTα-OSTβ complex facilitates sodium-independent transport of bile acids (e.g., taurocholate), estrone sulfate, and drugs (e.g., digoxin) .

  • Localization: Expressed in the ileum, liver, kidney, and adrenal glands, with highest expression in the gastrointestinal tract .

Recombinant OSTα Proteins

While "C18A3.4" is not described in the provided sources, recombinant OSTα proteins have been studied for their role in bile acid transport and disease models:

Key Research Findings

Study FocusMethodologyFindingsCitation
OSTα-OSTβ Knockout MiceGenetic ablation of OstαImpaired intestinal bile acid transport, reduced bile acid pool size, and altered hepatic bile acid synthesis due to disrupted FGF15 signaling .
NASH and CholestasisAnalysis of human liver tissuesHepatic OSTα/β overexpression in nonalcoholic steatohepatitis (NASH) and primary biliary cholangitis correlates with bile acid retention and drug interactions .
Hypoxia InductionCell culture under hypoxia (0.2% O₂)Hypoxia and FXR agonists synergistically upregulate OSTα/β expression, suggesting regulatory roles in bile acid transport during metabolic stress .

OSTα/β in Drug Interactions

OSTα/β interacts with pharmaceuticals, impacting drug disposition and toxicity:

  • Substrates: Taurocholate, estrone sulfate, dehydroepiandrosterone sulfate, and digoxin .

  • Inhibitors: Glycochenodeoxycholic acid (cholestasis biomarker), troglitazone sulfate, and fidaxomicin .

  • Clinical Relevance: OSTα/β overexpression in cholestatic liver diseases may exacerbate drug-induced hepatotoxicity .

Unresolved Questions and Research Gaps

  • The precise role of OSTα/β in extrahepatic tissues (e.g., adrenal glands) remains unclear .

  • No studies in the provided sources address "C18A3.4" or its homologs, suggesting this protein may require further characterization or exist under alternative nomenclature.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize development with the specified tag.
Synonyms
osta-2; C18A3.4; Organic solute transporter alpha-like protein 2; Solute carrier family 51 subunit alpha homolog A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
osta-2
Target Protein Sequence
MLEISPWETLVKLLTDSLLNCTGTHEDVPHAKTFLRSLTTTYIASLAVATAVTVGTVCLA VLHLIYIHFYITHSSRRLHIVLLACTAPLVSLLALVAMYMPRVWFLSHLLSFLYFSFALW VIICLLLHIFDGHHALVTKMMQRLQYVEIATPPFCCLFPCLPKVRLEGKKIRWCELMVMQ APIVRLFATLVSLVIYFEYQDQGLVPLKVLDFITLPSLLAGIYGTHILVTTVSRMDELIS YRYVVVFRLLDFFFMVFGLQQPVFDFLARYGAFGCGTVLPAIETSFYWKNFFTVIEAFCV TLISTVLLQPSKSSFFDKHPSCRSMSSARSTITDVDTDESTT
Uniprot No.

Target Background

Function
Probable transporter.
Database Links

KEGG: cel:CELE_C18A3.4

UniGene: Cel.6101

Protein Families
OST-alpha family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.