Recombinant Orgyia pseudotsugata multicapsid polyhedrosis virus Major envelope glycoprotein (GP64)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
GP64; P64; ORF126; Major envelope glycoprotein; gp64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-509
Protein Length
Full Length of Mature Protein
Species
Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
Target Names
GP64
Target Protein Sequence
AEHCNAQMKSGPWRIKSLPIAAPKETLQKDVEIEIVETDLDQNVVIGYKGYYQAYAYNGG SLDPNSRVEETMKTLDVAKEDLLMWGIRQQCEVGEELIDQWGSDSESCFRNMDGRGVWVA GKELVKRQNNNHFAHHTCNRSWRCGVSTAKMYTRLECDDDTDDCKVTILDINGTSINVTE NKVLHRDGVSMILKQKSTFSRRTEKVACLLIKDDKADPNSVTREHCLVDNDIFDLSKNTW FCKFNRCIKRRSENVVKQRPHTWRHDRPPKHDEGATATKGDLMHIQEELMYENDLLRMNL ELMHAHINKLNNMMHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTSPPPHTS NCYNNSIYKEGRWVANTDTSQCIDFNNYKELAIDDDIEFWIPTIGNTSYHESWKDASGWS FIAQQKSNLISTMENTKFGGHTTSLSDIADMAKGELNATLYSFMLGHGFTFVLIVGVILF LVCMLRNRPSHY
Uniprot No.

Target Background

Function

This envelope phosphoglycoprotein mediates the fusion of viral and host endosomal membranes, facilitating viral entry into the host cell.

Database Links

KEGG: vg:912029

Protein Families
Baculoviridae gp64 family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.

Q&A

What is GP64 and what is its primary role in baculovirus infection cycles?

GP64 is the major envelope glycoprotein found in the budded virus (BV) form of baculoviruses, including Orgyia pseudotsugata multicapsid nucleopolyhedrovirus (OpMNPV) and Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV). It plays essential roles in virus infection, serving as the primary mediator of both host cell receptor binding and low-pH-triggered membrane fusion during viral entry via endocytosis .

GP64 is a type I membrane protein that contains a predicted transmembrane (TM) domain ranging from approximately 16 to 23 amino acids in length, depending on the specific baculovirus . The protein is essential for production of infectious budded virus, as it facilitates both cell attachment and penetration processes. Unlike many viral envelope proteins, GP64 serves the dual function of attachment protein and fusion protein, making it critical to understanding baculovirus infection mechanisms .

How does the timing of GP64 expression affect viral pathogenesis in vivo?

Early synthesis of GP64 represents a key adaptation in baculovirus infection strategy. Research comparing recombinant viruses with wild-type temporal expression patterns (early and late) versus those that synthesize GP64 only late during infection revealed significant differences in infection dynamics .

Experiments with Heliothis virescens larvae demonstrated that AcLate21/20-64HB (a recombinant expressing GP64 only late) established secondary infection much more slowly and displayed significantly reduced virulence when administered orally compared to AcCtlNt-64HB (a recombinant with wild-type early and late GP64 expression) . Interestingly, when budded virus was injected directly into the larval hemocoel, bypassing midgut infection, virulence was identical between the two recombinants .

This temporal expression pattern contributes to a unique infection strategy where:

  • Early GP64 expression enables rapid budding of transcytosed nucleocapsids

  • The combination of multiple-nucleocapsid ODV packaging and early GP64 expression contributes to improved viral fitness

  • This mechanism likely reduces the effectiveness of the host's defensive sloughing response by initiating systemic infection hours before completion of de novo viral progeny synthesis

Which specific domains of GP64 are involved in host cell receptor binding?

The N-terminal region of GP64 has been identified as critical for receptor binding. Experimental evidence from antibody neutralization studies and truncation analyses has pinpointed the receptor binding domain to the N-terminal portion of the GP64 ectodomain .

Specifically, antibodies directed against the N-terminal region (amino acids 21 to 159) strongly neutralized viral infectivity and effectively inhibited binding of 35S-labeled budded virions to Sf9 cells . Further mapping using virions displaying truncated GP64 constructs demonstrated that the N-terminal 274 amino acids (residues 21 to 294) of the ectodomain were sufficient to mediate virion binding .

More detailed site-directed mutagenesis studies identified specific amino acid residues critical for receptor binding:

  • Amino acids 153 and 156 were shown to be particularly important, as substitution mutations at these positions (F153A and H156A) had substantial negative effects on virion binding to Sf9 cells

  • These amino acid positions were confirmed as important in both full-length GP64 and truncated GP64 constructs containing only the N-terminal receptor binding domain

  • In contrast, mutations at positions 120-124, 132, 142-148, 155, and 157 had no substantial effect on virus replication, suggesting these residues are not critical for receptor binding

How do N-linked glycans on GP64 affect receptor binding and virus infectivity?

N-linked glycans on GP64 play significant roles in receptor binding and virus infectivity. Research using site-directed mutagenesis has mapped four N-linked glycosylation sites on AcMNPV GP64 to amino acids 198, 355, 385, and 426 in the polypeptide chain .

Elimination of one or more N-glycosylation sites in AcMNPV GP64 impairs binding of budded virus to host cells, which directly correlates with reduced production of infectious progeny. Key findings include:

  • AcMNPV mutants lacking one, two, or three N-linked glycans on GP64 produced approximately 10- to 100-fold lower levels of infectious progeny compared to wild-type

  • This reduction correlated with slower binding of mutant viruses to Sf9 cells rather than with reductions in expression, transport, inherent fusogenic activity, or GP64 content of mutant budded virus particles

  • Processing of N-linked glycans on GP64 is subject to positional effects, with differences in the efficiency of processing of individual N-linked glycans

The data suggest that N-linked glycans contribute to the proper conformation of GP64 for optimal receptor binding, with their removal affecting the kinetics of virus attachment to host cells.

What critical features of the GP64 transmembrane domain affect its functionality?

The transmembrane (TM) domain of GP64 contains specific features that are essential for its functionality in membrane anchoring, membrane fusion, virus budding, and infectivity. Research has identified several key characteristics:

  • Hydrophobic Length: The length of the hydrophobic TM domain is critical for GP64-mediated membrane fusion activity. Experiments with truncated TM domains revealed that:

    • Most TM domain deletion constructs remained fusion competent

    • Constructs with deletions of eight amino acids from the C-terminus did not mediate detectable fusion

    • Addition of a single hydrophobic amino acid (A, L, or V) to the C-terminus of these severely truncated constructs restored fusion activity

  • Specific Amino Acid Positions: Analysis using single amino acid substitutions and 3-alanine scanning mutations identified important positions within the TM domain:

    • Amino acids at positions 485-487 and 503-505 are important for cell surface expression of GP64

    • Amino acids at positions 483-484 and 494-496 are important for virus budding

    • No specific residue was absolutely required for membrane fusion activity

  • Sequence Conservation: Unlike the highly conserved ectodomain (approximately 80% identical among baculovirus GP64 proteins), TM domain sequences show more variable conservation (13-100%)

The experimental evidence demonstrates that the TM domain is not merely a membrane anchor but plays active roles in multiple aspects of GP64 function, with specific sequence requirements for optimal performance.

How do TM domain modifications affect virus budding efficiency?

Modifications to the GP64 TM domain have significant effects on virus budding efficiency. Experimental data from studies using recombinant viruses expressing modified GP64 constructs demonstrated:

  • Removal of the cytoplasmic tail or truncation/deletion of the TM domain resulted in substantially decreased virus budding

  • Viruses expressing GP64 constructs with C-terminal deletions of 4-5 amino acids (C0, C4, C5) showed budding efficiencies of approximately 24-30% compared to wild-type GP64

  • Deletion of 7-8 amino acids from the TM domain resulted in progressive reduction in virion budding

  • Background virion budding in the absence of GP64 ranges from approximately 3-10% of wild-type levels

The data in Table 1 summarizes the relative budding efficiency of viruses expressing different GP64 TM domain modifications:

GP64 ConstructTM ModificationRelative Budding Efficiency (% of WT)
Wild-typeNone100%
C0, C4, C54-5 aa deletion24-30%
C77 aa deletionSignificantly reduced but detectable
C8, C8CT8 aa deletionNear background levels (3-10%)
N8CT, M8CT8 aa deletionNear background levels (3-10%)

These findings indicate that the integrity of the TM domain is critical for efficient virus budding, with even small modifications resulting in substantial functional impairment .

What techniques are most effective for characterizing GP64 expression patterns during infection?

Several complementary techniques have proven effective for characterizing GP64 expression patterns during baculovirus infection. Based on research methodologies, the following approaches are recommended:

  • Radioimmunoprecipitation Assays:

    • Pulse-labeling infected cells with [35S]methionine at various times post-infection

    • Immunoprecipitating GP64 using specific monoclonal antibodies (e.g., AcV1)

    • This technique allows detection of newly synthesized GP64 at specific time points

  • Immunoblotting (Western Blot) Analysis:

    • Collecting intracellular and extracellular fractions at various times post-infection

    • Resolving proteins by SDS-PAGE and transferring to membranes

    • Probing with GP64-specific antibodies

    • This technique reveals accumulation patterns of GP64 throughout infection

  • Primer Extension Analysis for Transcription Patterns:

    • Isolating total RNA from infected cells

    • Using primers complementary to the 5' end of the GP64 ORF

    • This technique identifies transcription start sites and regulatory elements

  • Reporter Gene Constructs:

    • Using chloramphenicol acetyltransferase (CAT) as a reporter under the control of GP64 promoter elements

    • Measuring CAT activity to assess promoter strength and temporal regulation

    • This approach allows dissection of regulatory elements controlling GP64 expression

For optimal results, combining these techniques provides comprehensive characterization of both transcriptional and translational regulation of GP64 during infection.

What are the established methods for studying GP64-mediated membrane fusion?

Several robust methodologies have been developed for investigating GP64-mediated membrane fusion:

  • Syncytium Formation Assays:

    • Exposing GP64-expressing cells to low pH conditions

    • Quantifying multinucleated syncytia formation

    • This visual assay provides a direct measure of membrane fusion activity

  • Fusion Reporter Systems:

    • Using reporter gene activation upon cytoplasmic mixing

    • Typically employing split reporter systems that activate upon fusion

    • Allows quantitative measurement of fusion efficiency

  • Virion Binding Assays:

    • Radiolabeling virions with [35S]methionine

    • Measuring binding to host cells at 4°C (to prevent endocytosis)

    • Quantifying bound virus after washing and cell lysis

    • This technique separates binding from subsequent fusion events

  • Site-Directed Mutagenesis Approaches:

    • Generating specific mutations in GP64

    • Assessing impact on fusion activity

    • Particularly useful for structure-function relationships

    • Often combined with syncytium assays to assess functional consequences

  • pH-Dependent Conformational Change Assays:

    • Using conformation-specific antibodies

    • Monitoring structural changes upon pH shift

    • Correlating conformational changes with fusion activity

These methods have been instrumental in identifying critical domains for GP64-mediated fusion, such as the hydrophobic length requirement of the TM domain and specific amino acid positions important for fusion activity .

How does the infection cycle of OpMNPV progress in terms of GP64 expression and viral production?

The infection cycle of Orgyia pseudotsugata multicapsid nuclear polyhedrosis virus (OpMNPV) follows a well-characterized progression with distinct phases of GP64 expression and viral production:

  • Early Phase (0-12 hours post-infection):

    • GP64 expression begins early during infection

    • DNA synthesis begins at 12-18 hours post-infection (p.i.)

    • Early GP64 expression is critical for subsequent viral spread

  • Late Phase (12-48 hours p.i.):

    • Rate of budded virus (BV) production reaches maximal levels at 24-36 hours p.i.

    • BV production continues at high levels throughout late infection

    • This indicates that BV production is not turned off during late stages

    • Polyhedra (occlusion bodies) are first observed at 48 hours p.i.

  • Very Late Phase (beyond 48 hours p.i.):

    • Continued production of occlusion bodies

    • Accumulation of polyhedrin protein

The multiplicity of infection (MOI) influences several aspects of this progression:

  • MOI affects the magnitude but not timing of early events (GP64 expression and DNA synthesis)

  • MOI influences initial levels of BV production and the percentage of cells containing occlusion bodies

  • MOI has little influence on final rates of BV production and detection timing of late viral proteins (p39 and polyhedrin)

This temporal progression demonstrates the biphasic nature of baculovirus infection, with early GP64 expression enabling efficient virus spread followed by late-phase production of occlusion bodies.

How can researchers use Google's "People Also Ask" data to optimize their experimental design for GP64 studies?

Google's "People Also Ask" (PAA) feature provides valuable insights into related questions that can help researchers optimize experimental design for GP64 studies. This approach offers several methodological advantages:

  • Comprehensive Research Planning:

    • PAA data appears in over 80% of English searches, generally within the first few results

    • Clicking on a question reveals an answer snippet and cascades additional related questions

    • This pattern allows researchers to map question clusters based on search intent that Google itself suggests

    • By systematically exploring these question clusters, researchers can identify knowledge gaps and experimental approaches not initially considered

  • Understanding Research Community Priorities:

    • PAA data reflects actual search behaviors and patterns from the research community

    • This reveals what aspects of GP64 other researchers find most challenging or interesting

    • For complex queries, Google's research indicates it takes on average eight searches to complete a task

    • By analyzing these search patterns, researchers can prioritize experiments addressing high-interest questions

  • Methodological Implementation:

    • Use tools like KeywordsPeopleUse.com to systematically mine PAA data relevant to GP64

    • Extract not only the questions but also:

      • The answers shown in search results

      • The URLs of webpages providing answers

      • The titles of source webpages

    • Build a research tree using these clusters to design a comprehensive experimental approach

  • Practical Application Example:

    • A search for "GP64 receptor binding domain" might generate PAAs about specific amino acid residues, experimental methods, or conflicting results

    • Based on this data, researchers could design experiments specifically addressing these questions

    • This approach ensures research contributions align with community interests and knowledge gaps

Using PAA data represents a data-driven approach to experimental design that can help researchers target their investigations to areas of greatest interest and potential impact within the scientific community .

What strategies have proven effective for creating functional GP64 mutants with specific modifications?

Several strategies have demonstrated success in creating functional GP64 mutants with specific modifications for research purposes:

  • Site-Directed Mutagenesis Approaches:

    • Single amino acid substitutions targeting specific functional residues

    • 3-alanine scanning mutations to identify important but not essential amino acid positions

    • This approach successfully identified residues 153 and 156 as critical for receptor binding

    • Substitution mutations at positions F153A and H156A had substantial negative effects on virion binding to Sf9 cells

  • N-Glycosylation Site Mutations:

    • Site-directed mutagenesis to map N-linked glycosylation sites

    • Systematic elimination of individual glycosylation sites (at amino acids 198, 355, 385, and 426)

    • Creation of single, double, and triple mutants to assess glycan contributions

    • This approach revealed that N-linked glycans significantly impact receptor binding and virus infectivity

  • Transmembrane Domain Modifications:

    • 4- to 8-amino-acid deletions from various positions within the TM domain

    • Addition of single hydrophobic amino acids to truncated constructs

    • Replacement of the TM domain with corresponding sequences from other viral or cellular type I membrane proteins

    • These studies demonstrated the critical importance of TM domain length for fusion activity

  • Bacmid-Based Recombination Systems:

    • Use of bacmid technologies for efficient generation of recombinant viruses

    • For example, modified GP64 constructs inserted into gp64 null AcMNPV bacmid

    • Expression in cells stably expressing OpMNPV GP64 (cell line Sf9Op1D) to complement the null bacmid

    • This system allows rapid generation and testing of GP64 mutants

  • Truncation Analysis:

    • Generation of virions displaying truncated GP64 constructs

    • This approach successfully mapped the receptor binding domain to the N-terminal region

    • A construct displaying the N-terminal 274 amino acids (residues 21 to 294) was sufficient to mediate virion binding

The most successful GP64 engineering approaches combine multiple techniques and include appropriate control constructs to validate findings across different experimental systems.

How do different promoter systems affect the expression patterns and functionality of recombinant GP64?

Research on promoter systems for GP64 expression has revealed important insights about how temporal regulation affects GP64 functionality:

  • Native GP64 Promoter Regulation:

    • The gp64 gene is regulated by both early and late promoter elements

    • Early expression is driven by a TATA-containing promoter with transcription start sites approximately 40 nucleotides upstream of the translation start codon

    • Late expression occurs during the viral DNA replication phase

  • Experimental Promoter Manipulations:

    • Replacing the native early promoter with exclusively late promoters (e.g., the very late polyhedrin promoter) significantly affects viral pathogenesis in vivo

    • Recombinants designed to produce GP64 only late during infection (AcLate21/20-64HB) established secondary infection much more slowly and displayed reduced virulence compared to those with wild-type temporal expression patterns (early and late, AcCtlNt-64HB)

    • This effect was only observed during oral infection, not when BV was injected directly into the hemocoel

  • Reporter Gene Studies:

    • Chloramphenicol acetyltransferase (CAT) reporter constructs under control of various GP64 promoter elements have been used to dissect regulatory regions

    • These studies have identified specific sequence elements controlling early versus late expression

  • Baculovirus Expression Vector Systems:

    • When using GP64 in heterologous expression systems, the choice of promoter significantly impacts protein yield and timing

    • The polyhedrin and p10 promoters provide very high-level late expression but lack the early expression component critical for GP64's role in the infection cycle

The experimental evidence indicates that the temporal pattern of GP64 expression is as important as the total amount of protein produced, particularly for applications requiring functional studies of virus entry and pathogenesis .

How do the functional domains of GP64 compare between OpMNPV and AcMNPV?

OpMNPV (Orgyia pseudotsugata multicapsid nucleopolyhedrovirus) and AcMNPV (Autographa californica multicapsid nucleopolyhedrovirus) GP64 proteins share significant structural and functional similarities but also exhibit important differences:

  • Sequence Conservation:

    • The ectodomain sequences are highly conserved, with approximately 80% identity between baculovirus GP64 proteins

    • In contrast, the transmembrane (TM) domain sequences show more variable conservation (13-100%)

  • Receptor Binding Domain:

    • Both viruses utilize the N-terminal region of GP64 for receptor binding

    • AcMNPV GP64 studies have identified specific amino acid residues (153 and 156) as critical for receptor binding

    • Comparable studies with OpMNPV GP64 have shown similar N-terminal binding regions

  • N-linked Glycosylation:

    • AcMNPV GP64 contains four N-linked glycosylation sites (amino acids 198, 355, 385, and 426)

    • The processing of these glycans varies by position, with some acquiring partial endo H resistance

    • Only glycans that acquire at least partial endo H resistance contain detectable levels of fucose

    • None of the glycans on AcMNPV GP64 are processed to complex structures containing β-linked galactose or α2,6-linked sialic acid

  • Functional Complementation:

    • OpMNPV GP64 can functionally substitute for AcMNPV GP64

    • Cell lines stably expressing OpMNPV GP64 (Sf9Op1D) can support the replication of gp64-null AcMNPV recombinants

    • This functional complementation indicates conservation of critical domains despite sequence variations

  • Infection Kinetics:

    • Both viruses show similar progression of infection:

      • DNA synthesis begins at 12-18 hours post-infection

      • Budded virus production reaches maximal levels at 24-36 hours p.i.

      • Polyhedra formation begins around 48 hours p.i.

    • The basic infection parameters appear conserved between the two viruses

This comparative analysis demonstrates that while the core functions of GP64 are conserved between OpMNPV and AcMNPV, specific sequence variations may contribute to differences in host range and infection efficiency between these baculoviruses.

What are the most promising approaches for using GP64 knowledge to enhance baculovirus expression vector systems?

Based on current understanding of GP64 structure and function, several promising approaches emerge for enhancing baculovirus expression vector systems:

  • Optimized Temporal Expression Patterns:

    • Engineering expression systems with carefully timed GP64 expression

    • Early GP64 expression is critical for efficient viral spread and optimal infection kinetics

    • Systems could incorporate dual promoters to ensure both early and late expression phases

    • This approach could enhance virus titers and expression levels of recombinant proteins

  • GP64 N-Glycosylation Engineering:

    • Selective modification of N-glycosylation sites to enhance host cell binding

    • Creating mutants with optimized glycosylation patterns for specific cell types

    • This approach could improve tissue or cell-type specificity of baculovirus vectors

    • Potential applications in targeted gene delivery for specialized expression systems

  • Receptor Binding Domain Modifications:

    • Engineering the N-terminal region (amino acids 21-159) responsible for receptor binding

    • Creating chimeric proteins with mammalian-cell targeting domains

    • This could expand the host range of baculovirus vectors for applications in mammalian cell expression

  • Transmembrane Domain Optimization:

    • Fine-tuning the length and composition of the TM domain for optimal membrane fusion and budding efficiency

    • Creating enhanced variants with greater stability or activity

    • This approach could improve virus production and gene delivery efficiency

  • Combination with People Also Ask (PAA) Data Mining:

    • Using PAA data to identify researcher priorities and challenges in baculovirus expression systems

    • Targeting improvements to address specific limitations identified through search behavior analysis

    • This data-driven approach ensures developments align with actual researcher needs

These approaches represent promising directions for leveraging GP64 knowledge to create next-generation baculovirus expression systems with enhanced properties for research and biotechnology applications.

What unresolved questions about GP64 structure-function relationships warrant further investigation?

Despite significant advances in understanding GP64, several important questions about its structure-function relationships remain unresolved and warrant further investigation:

  • Detailed Receptor Binding Mechanisms:

    • While amino acids 153 and 156 are known to be important for receptor binding , the precise molecular interactions remain unclear

    • The identity of the cellular receptor(s) for GP64 in insect cells is still not definitively established

    • Structure-based studies combining crystallography and cryo-EM approaches could reveal the binding interface at atomic resolution

  • Fusion Triggering Mechanism:

    • The conformational changes that occur in GP64 upon exposure to low pH are not fully characterized

    • Unlike other viral fusion proteins, the intermediate structures during the fusion process remain poorly understood

    • Time-resolved structural studies during the fusion process could provide valuable insights

  • Interplay Between Glycosylation and Function:

    • While N-linked glycans affect receptor binding , the specific contributions of each glycan to protein folding, stability, and receptor interactions need further characterization

    • The role of specific glycan structures (as opposed to simply their presence/absence) remains to be determined

  • Cytoplasmic Tail Interactions:

    • The interactions between GP64's cytoplasmic tail and viral/cellular components during budding are not fully characterized

    • Potential interactions with the viral matrix protein and cytoskeletal elements warrant investigation

    • These studies could reveal mechanisms controlling the incorporation of GP64 into budding virions

  • Species-Specific Adaptations:

    • The evolutionary pressures driving variations in GP64 sequences across baculovirus species remain unclear

    • Comparative studies across different baculoviruses could reveal adaptive changes related to host specificity

  • Structural Determinants of Membrane Curvature:

    • How GP64 influences membrane curvature during both fusion and budding processes

    • The potential cooperative interactions between multiple GP64 trimers during these processes

  • Integration of Early and Late Functions:

    • The molecular basis for how early GP64 expression enhances infection kinetics beyond simply making the protein available earlier

    • Potential regulatory roles of GP64 in the viral infection cycle beyond receptor binding and fusion

Addressing these questions will require interdisciplinary approaches combining structural biology, molecular virology, glycobiology, and advanced imaging techniques. The results would not only enhance fundamental understanding of baculovirus biology but could also lead to improved biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.