Recombinant Orientia tsutsugamushi Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role in Bacterial Pathogenesis

LspA is an aspartyl protease essential for processing lipoproteins in Gram-negative bacteria:

  • Function: Cleaves the N-terminal signal peptide of prolipoproteins, enabling their maturation and membrane anchoring .

  • Structural Dynamics: Molecular dynamics simulations reveal conformational flexibility in the apo state, adopting both open (substrate-binding) and closed (inactive) states. Antibiotics like globomycin stabilize intermediate conformations to inhibit activity .

  • Virulence Link: In Streptococcus uberis, LspA disruption alters lipoprotein processing (e.g., MtuA), reducing bacterial virulence .

Antibiotic Target Validation

LspA is a promising target due to its essentiality in pathogenic bacteria and low resistance development risk:

  • Globomycin Inhibition: Binds LspA’s active site, blocking signal peptide cleavage. Structural studies highlight conserved residues (Asp124, Asp143) critical for catalysis .

  • Therapeutic Potential: Hybrid MD/EPR approaches have identified novel binding modes for next-generation inhibitors .

Diagnostic and Vaccine Development

While LspA itself is not a direct vaccine candidate, related O. tsutsugamushi antigens (e.g., TSA56, ScaA) are prioritized:

  • Recombinant Antigens: Truncated TSA56 (amino acids 88–479) and ScaA (607–994) are used in intranasal nanoparticle vaccines, enhancing T-cell and humoral immunity .

  • Cross-Reactivity: LspA’s conserved regions across Orientia strains suggest utility in broad-spectrum diagnostic assays .

Comparative Genomics and Evolution

O. tsutsugamushi exhibits high genetic diversity driven by recombination:

  • MLST Analysis: Hainan Island isolates form distinct clonal complexes (ST111–ST175) with unique LspA sequences .

  • Recombination Hotspots: The 56-kDa TSA gene undergoes frequent intragenic recombination, though LspA remains relatively conserved .

Future Directions

  • Structural Biology: Cryo-EM studies of recombinant LspA bound to substrates/inhibitors could refine drug design.

  • Animal Models: Testing LspA knockout strains in scrub typhus models (e.g., mice) may clarify its role in immune evasion.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; OTBS_2043; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Orientia tsutsugamushi (strain Boryong) (Rickettsia tsutsugamushi)
Target Names
lspA
Target Protein Sequence
MLLEQVIYIMCNLEVSKNNSSRNKLWSLIFGTQLLIIDQLVKSFFINFLKKTPGIAISIF KYFKISYVWNYGISFGIFNYYYDIGNIFFLIVNTIIVLCICYLITKAKKLLQFNAYMLVI IGGTSNIIDRMLYGAVFDFIDIYLIIFNLADLYIFVGTILLVIYYSYYE
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Orientia tsutsugamushi Lipoprotein signal peptidase (lspA)?

Orientia tsutsugamushi Lipoprotein signal peptidase (lspA) is an enzyme encoded by the lspA gene (UniProt ID: A5CFG7) that plays a critical role in bacterial lipoprotein processing. The full-length protein consists of 169 amino acids and functions by cleaving signal peptides from prelipoproteins, a crucial step in the formation of mature lipoproteins essential for bacterial cell envelope integrity. LspA is also known as prolipoprotein signal peptidase, signal peptidase II, or SPase II .

How does lspA contribute to bacterial cell envelope integrity?

LspA contributes to bacterial cell envelope integrity through its enzymatic role in lipoprotein maturation. In Orientia tsutsugamushi, which possesses a peptidoglycan-like structure, lspA processes prelipoproteins that become integral components of the cell envelope. This processing is critical for:

  • Proper localization of lipoproteins in the cell envelope

  • Maintenance of outer membrane stability

  • Supporting the peptidoglycan-like structure that encases the bacterial cell

What are the optimal methods for expressing recombinant lspA?

For successful expression of recombinant Orientia tsutsugamushi lspA, researchers should follow these methodological approaches:

  • Expression System Selection: E. coli is the preferred expression system for recombinant lspA production

  • Vector Design: Incorporate an N-terminal His-tag to facilitate downstream purification processes

  • Expression Conditions:

    • Use standard E. coli culture conditions with appropriate induction parameters

    • Monitor expression levels through small-scale test expressions

    • Optimize temperature, induction time, and inducer concentration for maximum yield

  • Purification Protocol:

    • Lyse cells under appropriate buffer conditions

    • Purify using affinity chromatography (His-tag binding)

    • Verify purity using SDS-PAGE (>90% purity is achievable)

  • Storage Recommendations:

    • Store as lyophilized powder

    • Avoid repeated freeze-thaw cycles

    • Store at -20°C/-80°C upon receipt

    • For working stocks, add 5-50% glycerol and aliquot for long-term storage

How can researchers detect the peptidoglycan-like structure in Orientia tsutsugamushi?

Detection of the peptidoglycan-like structure in Orientia tsutsugamushi requires specialized techniques:

Detection MethodPrincipleKey Findings in O. tsutsugamushi
GC/EIMS AnalysisDetection of diaminopimelic acid (DAP) in acid hydrolysates through gas chromatography/electron impact mass spectrometryIdentified DAP with a retention time of 22.2 minutes and fragment ions at 380, 324, 306, and 278 m/z, suggesting peptidoglycan presence
Enzymatic Sensitivity TestsTreatment with lysozyme and mutanolysin that cleave β-1,4-linkages between N-acetylmuramic acid and N-acetyl-glucosamineResulted in bacterial cell lysis and reduction in bacterial copy number, confirming presence of glycan backbone
Fluorescent D-amino acid labelingHADA/EDA-DA labeling to visualize peptidoglycanRevealed an extended sacculus-like structure encasing the bacterial cell, different from the septal localization seen in chlamydiae

What are the methodological challenges in isolating the peptidoglycan-like structure from Orientia tsutsugamushi?

Researchers face significant methodological challenges when attempting to isolate the peptidoglycan-like structure:

  • Biochemical isolation attempts have been largely unsuccessful, likely due to:

    • Low abundance of peptidoglycan material

    • Unknown regulatory mechanisms affecting biosynthesis during different infection stages

    • Unique structural properties requiring specialized isolation techniques

  • The analysis is further complicated by O. tsutsugamushi's obligate intracellular lifestyle, making it difficult to obtain sufficient bacterial biomass for structural studies

How can recombinant lspA be utilized for diagnostics of scrub typhus?

Recombinant lspA has potential applications in scrub typhus diagnostics based on similar approaches used with other O. tsutsugamushi proteins:

  • Serological Testing: Research indicates recombinant O. tsutsugamushi proteins can be used in ELISA to detect antibodies in patient sera, with particularly strong results for IgM detection in high-titer samples (1:1600)

  • Cross-reactivity Analysis: Recombinant proteins from O. tsutsugamushi demonstrate serologic cross-reactivity with antisera against various O. tsutsugamushi serotypes while showing specificity (no cross-reactivity with other rickettsial species including R. typhi, R. prowazekii, and TT118 SFG rickettsiae)

  • Diagnostic Development Considerations:

    • Higher affinity observed for antihuman IgM than IgG

    • Multiple antigens may be required for effective serodiagnosis in endemic areas

    • Results correlate well with indirect immunoperoxidase assay findings

What is the significance of O. tsutsugamushi's peptidoglycan-like structure for antibiotic research?

The discovery of a peptidoglycan-like structure in O. tsutsugamushi has significant implications for antibiotic research:

  • Paradigm Shift: Contradicts previous reports that O. tsutsugamushi completely lacks peptidoglycan, fundamentally changing our understanding of this organism's cell wall structure

  • Antibiotic Susceptibility: Suggests potential susceptibility to cell wall-targeting antibiotics, opening new treatment avenues for scrub typhus

  • Genomic Analysis Insights: Despite having a nearly complete set of genes required for peptidoglycan biosynthesis, O. tsutsugamushi lacks three important enzyme groups:

    • Amino acid racemases

    • Glycosyltransferases

    • Some genes in the meso-diaminopimelic acid biosynthesis pathway

  • Evolutionary Perspective: Shows striking similarities to the unrelated Chlamydiales, suggesting convergent adaptation to an obligate intracellular lifestyle

How do the structure and function of lspA in Orientia tsutsugamushi compare to homologous proteins in other bacteria?

This comparative analysis reveals important insights about bacterial adaptation:

  • Structural Conservation: The 169-amino acid sequence of O. tsutsugamushi lspA shows conserved domains typical of bacterial signal peptidases II

  • Functional Homology: Despite O. tsutsugamushi's reduced genome, lspA functionality appears preserved, suggesting essential roles in bacterial survival

  • Evolutionary Implications: The retention of lspA despite genome reduction suggests strong selective pressure to maintain lipoprotein processing capabilities in this obligate intracellular pathogen

What are the complexities in understanding peptidoglycan synthesis in O. tsutsugamushi given its genomic deficiencies?

O. tsutsugamushi presents a fascinating genomic puzzle regarding peptidoglycan synthesis:

  • Missing Enzymatic Pathways: Despite evidence of a peptidoglycan-like structure, three key enzymatic groups are absent:

    • Amino acid racemases (required for D-amino acid formation)

    • Glycosyltransferases (needed for glycan chain polymerization)

    • Elements of the meso-DAP biosynthesis pathway

  • Potential Compensatory Mechanisms:

    • SEDS proteins RodA and FtsW may substitute for missing glycosyltransferase activity

    • Alternative pathways for D-amino acid generation remain unidentified

    • Possible host-derived precursor acquisition

  • Research Approaches to Address These Gaps:

    • Comparative genomics across O. tsutsugamushi strains

    • Metabolic labeling studies to trace peptidoglycan precursor incorporation

    • Inhibitor studies targeting predicted alternative pathways

What methodological approaches can overcome the challenges of studying an obligate intracellular bacterium like O. tsutsugamushi?

Advanced researchers must employ specialized approaches to study O. tsutsugamushi:

  • Cell Culture Systems:

    • Optimization of host cell infection models

    • Development of methods to synchronize infection cycles

    • Techniques for selective enrichment of bacterial components from host material

  • Advanced Analytical Techniques:

    • Super-resolution microscopy for structural visualization

    • Mass spectrometry-based approaches for detecting low-abundance peptidoglycan components

    • Single-cell analysis methods to account for heterogeneity in bacterial populations

  • Molecular Tools:

    • Development of genetic manipulation techniques specific to O. tsutsugamushi

    • CRISPR-based approaches for targeted gene modification

    • Reporter systems compatible with intracellular pathogens

What are the potential therapeutic applications targeting lspA in O. tsutsugamushi?

Strategic research into lspA-targeting therapeutics should consider:

  • Inhibitor Development: Design of specific inhibitors that target unique structural features of O. tsutsugamushi lspA

  • Combination Therapy Approaches: Investigation of synergistic effects between lspA inhibitors and conventional antibiotics

  • Delivery System Development: Creation of specialized delivery systems capable of targeting intracellular bacteria within host cells

  • Resistance Mechanism Studies: Proactive investigation of potential resistance mechanisms to lspA-targeting compounds

How might advanced structural studies of lspA inform bacterial cell envelope biology?

Future structural biology research on lspA could reveal:

  • Detailed Mechanistic Insights: Advanced structural determination (X-ray crystallography, cryo-EM) of lspA to understand the catalytic mechanism at atomic resolution

  • Structure-Function Relationships: Correlation between structural features and enzymatic activities through site-directed mutagenesis and activity assays

  • Comparative Structural Biology: Analysis of lspA structures across diverse bacterial species to identify conserved features and species-specific adaptations

  • Interaction Networks: Characterization of protein-protein interactions between lspA and other components of the lipoprotein processing machinery

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.