Recombinant Ornithorhynchus anatinus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Ornithorhynchus anatinus (Duckbill platypus)
Target Names
Target Protein Sequence
MNENLFAPFITPTVLGISVLPLIMIFPCLLFSTSNRWVPNRLIALQLWLVRLITKQMMMM HNKQGRMWTLMLITLIIFIASTNLLGLLPYTFTPTTQLSMNMGMAIPLWMGTVLMGFRNK PKASLAHFLPQGTPTPLIPMLIIIETISLFIQPLALAVRLTANITAGHLLIHLIGSATLA LSSISLTVSTITFTILFLLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is produced by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its functional significance in mitochondrial energy production?

MT-ATP6 is a mitochondrially encoded protein that functions as a critical component of the ATP synthase complex (Complex V). Specifically, it forms part of the F₀ segment of the enzyme, which is embedded in the inner mitochondrial membrane. The MT-ATP6 subunit plays an essential role in the proton channel, allowing positively charged ions (protons) to flow across the specialized inner mitochondrial membrane . This proton flow drives the rotary mechanism of ATP synthase, enabling the F₁ portion to catalyze the phosphorylation of ADP to ATP .

In the functional context, MT-ATP6 provides a crucial pathway for protons to pass from the intermembrane space into the mitochondrial matrix via the c-ring structure . This movement harnesses the energy of the proton electrochemical gradient, which has two components: a pH differential and an electrical membrane potential (Δψm) . The released energy causes rotation of two rotary motors: the ring of c subunits in F₀ and subunits γ, δ, and ε in F₁, to which it is attached .

What are the structural characteristics of platypus MT-ATP6?

The platypus (Ornithorhynchus anatinus) MT-ATP6 protein is composed of 226 amino acids with a molecular weight of approximately 24.8 kDa, similar to its human counterpart . The full amino acid sequence includes regions essential for proton transport and interaction with other ATP synthase subunits . The sequence contains multiple hydrophobic segments that anchor the protein within the inner mitochondrial membrane, consistent with its role in the transmembrane F₀ portion of ATP synthase .

The protein's functional domains include specific regions involved in proton transport, such as the path followed by protons from the intermembrane space to the mitochondrial matrix . Of particular note is the region containing amino acid position 163, where mutations can significantly impact protein function, as demonstrated in comparable studies with mouse models .

How does recombinant platypus MT-ATP6 differ from native protein in structural and functional properties?

Recombinant Ornithorhynchus anatinus MT-ATP6 typically contains additional elements not present in the native protein, including tags for purification and detection purposes that may be determined during the production process . These modifications can influence the protein's behavior in experimental systems and must be considered when interpreting results.

The recombinant protein is typically produced in expression systems that differ from the native mitochondrial environment, potentially affecting post-translational modifications and folding. While the amino acid sequence remains consistent with the native protein (positions 1-226 of the full-length protein), the absence of the native mitochondrial membrane environment may impact certain functional aspects . Researchers must carefully consider these differences when designing experiments and interpreting results, particularly when assessing proton transport activity or interactions with other subunits of the ATP synthase complex.

What established protocols exist for storing and handling recombinant platypus MT-ATP6?

For optimal preservation of recombinant platypus MT-ATP6, storage in a Tris-based buffer with 50% glycerol at -20°C is recommended . For extended storage periods, maintaining the protein at -20°C or -80°C helps preserve structural integrity and functional activity . Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing is not recommended due to potential protein degradation and activity loss .

When handling the protein, researchers should maintain appropriate buffer conditions optimized for this specific protein to prevent denaturation. The protein should be thawed gently when removed from frozen storage, preferably on ice, to preserve its native conformation. For experimental procedures, the buffer composition may need to be adjusted depending on the specific application, particularly when assessing functional activities related to ATP synthesis or proton transport.

What experimental models are most appropriate for studying recombinant platypus MT-ATP6?

In vitro reconstitution systems incorporating purified recombinant MT-ATP6 into liposomes or nanodiscs represent effective approaches for studying the protein's proton transport function. These systems allow researchers to control the lipid environment and assess functional parameters in isolation from other cellular components.

Cell-based models using cells depleted of endogenous MT-ATP6 (through mtDNA depletion or CRISPR-based approaches) can be complemented with recombinant platypus MT-ATP6 to study cross-species compatibility and functional conservation . Mouse cell lines carrying mutations in mt-Atp6 have been established and characterized, providing valuable comparative models for studying the functional consequences of specific amino acid changes .

Isolated mitochondria systems allow for the assessment of ATP synthase function in a more physiologically relevant context. By comparing ATP synthesis rates, oxygen consumption, and membrane potential in systems with and without recombinant platypus MT-ATP6, researchers can evaluate the protein's functional integration into the respiratory chain.

How can mutations in platypus MT-ATP6 inform our understanding of human mitochondrial disorders?

Pathological mutations in human MT-ATP6 gene are associated with various neurodegenerative disorders, including Leigh syndrome, which affects approximately 10-20% of patients with this condition . Research using platypus MT-ATP6 can provide evolutionary context for understanding conserved functional domains and residues critical for ATP synthase activity across species.

An experimental approach using site-directed mutagenesis of platypus MT-ATP6 to mirror human pathological mutations can reveal whether these mutations affect function similarly across evolutionary distinct species. For example, introducing mutations in highly conserved residues, such as position N163 (comparable to the mouse model with the p.N163S mutation), can help determine whether functional consequences are conserved . The mouse model with this mutation displayed characteristics similar to human MT-ATP6-related diseases, including glycolysis dependence, defective OXPHOS activity, ATP synthesis impairment, increased ROS generation, and altered mitochondrial membrane potential .

This comparative approach provides insights into which functional domains have remained evolutionarily conserved and which have adapted to species-specific metabolic requirements. The data from such studies can guide therapeutic development by identifying conserved targets that may respond similarly to interventions across species.

What techniques are most effective for assessing the integration of recombinant platypus MT-ATP6 into functional ATP synthase complexes?

Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) and Clear Native PAGE (CN-PAGE) represent powerful techniques for analyzing the incorporation of recombinant platypus MT-ATP6 into ATP synthase complexes . CN-PAGE, using milder detergents than BN-PAGE, can preserve complex V integrity better and allow visualization of assembly intermediates or subcomplexes .

ATP hydrolysis/synthesis assays directly measure functional activity of ATP synthase complexes containing recombinant MT-ATP6. Researchers can compare ATP production rates in reconstituted systems or isolated mitochondria with various versions of the MT-ATP6 protein to assess functional integration.

Proteomic approaches combining immunoprecipitation with mass spectrometry can identify binding partners of recombinant platypus MT-ATP6, confirming proper protein-protein interactions within the ATP synthase complex. Cross-linking studies prior to mass spectrometry analysis can capture transient interactions during the assembly process.

Real-time monitoring of proton flux and membrane potential using fluorescent probes (such as TMRM or JC-1) can assess the functional contribution of recombinant MT-ATP6 to maintaining the proton gradient essential for ATP synthesis . This approach provides direct evidence of proper integration into functional ATP synthase complexes.

How does the assembly pathway of ATP synthase containing platypus MT-ATP6 compare to other mammalian systems?

Current evidence suggests that mammalian ATP synthase assembly follows a modular pathway, with the MT-ATP6 and A6L subunits typically incorporated at the final stages of assembly . The assembly process likely begins with c-ring formation, followed by binding of F₁, attachment of the stator arm, and finally the addition of subunits a (MT-ATP6) and A6L .

To compare platypus ATP synthase assembly with other mammalian systems, researchers can employ pulse-chase experiments with radioactively labeled amino acids, tracking the incorporation of newly synthesized subunits into assembling complexes over time. This approach would reveal whether the timing of platypus MT-ATP6 incorporation matches the pattern observed in human and other mammalian systems.

Subunit-specific antibodies can be used to immunoprecipitate assembly intermediates at various stages, followed by mass spectrometry analysis to identify associated proteins. This technique can map the temporal sequence of subunit incorporation and identify any platypus-specific assembly factors or chaperones involved in the process.

Complementation studies in cells lacking endogenous MT-ATP6 can assess whether platypus MT-ATP6 can functionally replace the protein in other mammalian systems. The efficiency of complex formation and resulting ATP synthesis rates would indicate the degree of conservation in assembly mechanisms across species.

What is the role of MT-ATP6 in ATP synthase oligomerization and its impact on mitochondrial morphology?

MT-ATP6 plays a crucial role in stabilizing the holocomplex V structure, which is essential for the formation of ATP synthase dimers and higher-order oligomers . These oligomeric structures contribute to the shaping of cristae in the inner mitochondrial membrane, directly influencing mitochondrial morphology .

Researchers investigating platypus MT-ATP6's role in oligomerization can use electron microscopy techniques to visualize the arrangement of ATP synthase complexes in reconstituted membrane systems or isolated mitochondria. Comparing systems with wild-type versus mutated platypus MT-ATP6 can reveal specific domains involved in dimer/oligomer formation.

Super-resolution microscopy of fluorescently tagged ATP synthase components in living cells can track the dynamic formation of oligomeric structures and their relationship to changes in mitochondrial morphology. This approach can determine whether platypus MT-ATP6 supports oligomerization comparable to other mammalian systems.

Crosslinking studies combined with mass spectrometry can identify specific residues of platypus MT-ATP6 that interact with neighboring ATP synthase complexes in dimers or oligomers. These interaction sites can then be compared with those identified in human and other mammalian systems to assess evolutionary conservation of oligomerization mechanisms.

How can platypus MT-ATP6 research contribute to understanding the relationship between ATP synthase dysfunction and oncogenesis?

Recent research suggests a potential protective role of ATP synthase inhibition against tumor transformation, indicating a complex relationship between mitochondrial energy production and cancer development . Studies in mouse cells with mutations in mt-Atp6 have shown reduced migration capacity, higher expression of MHC-I, and slightly lower levels of HIF-1α, potentially indicating reduced tumorigenic potential .

To explore this relationship using platypus MT-ATP6, researchers can develop cell lines expressing wild-type or mutated versions of the protein and assess various cancer-related phenotypes, including proliferation rates, migration capacity, resistance to apoptosis, and metabolic profiles. This comparative approach can reveal whether the anti-tumorigenic effects are conserved across species.

Metabolomic profiling of cells expressing various forms of platypus MT-ATP6 can identify specific metabolic pathways altered by ATP synthase dysfunction. These metabolic signatures can be compared with those observed in cancer cells to identify common or divergent features.

Xenograft models using cells with manipulated platypus MT-ATP6 expression or function can assess in vivo tumor formation and growth rates. This approach provides physiologically relevant data on how ATP synthase alterations affect tumor development in complex organismal environments.

What protein interaction studies are most informative for understanding MT-ATP6 in the context of ATP synthase complex?

Co-immunoprecipitation studies combined with Western blotting or mass spectrometry represent fundamental approaches for identifying protein-protein interactions involving platypus MT-ATP6. This technique can confirm interactions with other ATP synthase subunits and potential regulatory proteins.

Proximity labeling methods, such as BioID or APEX2, involve fusing a biotin ligase to MT-ATP6, allowing biotinylation of proteins in close proximity within the living cell. This approach can identify transient or weak interactions that might be lost during traditional co-immunoprecipitation procedures.

Förster Resonance Energy Transfer (FRET) or Bioluminescence Resonance Energy Transfer (BRET) techniques can detect interactions between fluorescently tagged MT-ATP6 and other ATP synthase components in living cells. These approaches provide spatial information about the organization of the complex in the native membrane environment.

Cross-linking mass spectrometry (XL-MS) involves chemically cross-linking interacting proteins followed by mass spectrometry analysis to identify specific residues involved in protein-protein interactions. This method can map interaction interfaces with amino acid resolution, providing detailed structural information about how MT-ATP6 interfaces with other subunits.

What are the challenges in expressing and purifying functional recombinant MT-ATP6?

MT-ATP6 is a highly hydrophobic membrane protein, presenting significant challenges for heterologous expression and purification. Expression in bacterial systems often leads to inclusion body formation, requiring refolding procedures that may not yield properly folded, functional protein.

For successful expression, researchers should consider:

  • Eukaryotic expression systems (yeast, insect cells, or mammalian cells) that better support membrane protein folding

  • Expression as fusion proteins with solubility-enhancing tags (such as MBP or SUMO)

  • Co-expression with other ATP synthase subunits to promote proper folding and assembly

  • Use of specialized E. coli strains designed for membrane protein expression

Purification challenges include:

  • Selection of appropriate detergents that maintain protein structure and function

  • Development of a multi-step purification strategy that preserves native conformation

  • Implementation of activity assays at each purification step to track functional protein

  • Consideration of reconstitution into liposomes or nanodiscs to provide a lipid environment

How can researchers assess the functional activity of recombinant MT-ATP6?

ATP synthesis/hydrolysis assays represent the most direct measure of ATP synthase function. Researchers can reconstitute purified recombinant MT-ATP6 with other ATP synthase components and measure ATP production rates under varying conditions, such as different pH gradients or in the presence of specific inhibitors.

Proton transport assays using pH-sensitive fluorescent dyes in reconstituted liposome systems can specifically assess the proton channel function of MT-ATP6. These assays can determine whether recombinant platypus MT-ATP6 properly facilitates proton movement across membranes.

Membrane potential measurements using voltage-sensitive dyes (such as TMRM or JC-1) can assess the impact of recombinant MT-ATP6 on maintaining or dissipating the proton gradient . These measurements provide insights into the protein's functional integration into the proton transport machinery.

Oxygen consumption rate (OCR) analysis using platforms like Seahorse XF Analyzer can measure respiratory capacity in cells expressing recombinant platypus MT-ATP6. Comparing OCR profiles under different conditions (such as in the presence of oligomycin, an ATP synthase inhibitor) can reveal functional aspects of the recombinant protein.

What control proteins should be included in comparative studies involving platypus MT-ATP6?

Human MT-ATP6 serves as a primary control, allowing direct comparison with a well-characterized mammalian counterpart. This comparison can highlight conservation or divergence in function related to evolutionary distance.

MT-ATP6 from evolutionary intermediates (such as marsupials) can provide context for understanding the evolutionary trajectory of this protein from monotremes to placental mammals. This phylogenetic approach can reveal which functional features emerged at different points in mammalian evolution.

Non-functional MT-ATP6 mutants with well-characterized defects provide negative controls to validate assay sensitivity. Mutations known to abolish proton transport or disrupt critical protein-protein interactions can serve this purpose.

Other F₀ subunits from platypus ATP synthase should be included to assess subunit-specific effects versus general patterns of evolutionary conservation in the F₀ sector.

Nuclear-encoded ATP synthase subunits from platypus can serve as controls to distinguish between evolutionary patterns specific to mitochondrially encoded subunits versus those affecting the entire complex.

What are the optimal experimental designs for studying the effect of mutations in platypus MT-ATP6?

Site-directed mutagenesis of conserved residues based on known human pathogenic mutations represents a powerful approach. For example, creating a platypus equivalent of the mouse p.N163S mutation would allow direct comparison of functional consequences across species . This approach can identify which pathogenic mechanisms are conserved through evolution.

Creation of a comprehensive mutation library targeting different functional domains enables systematic analysis of structure-function relationships. By generating multiple mutations across the protein and assessing their impact on various aspects of ATP synthase function, researchers can map critical regions and residues.

Complementation studies in cells lacking endogenous MT-ATP6 (through mtDNA depletion or gene editing) provide a clean system for testing mutant protein function. By expressing wild-type or mutant platypus MT-ATP6 in these cells and assessing restoration of ATP synthesis, researchers can directly measure functional consequences of specific mutations.

Combinatorial mutations affecting interaction interfaces with other subunits can reveal cooperative functional relationships. This approach can determine whether certain regions of platypus MT-ATP6 have evolved to optimize interactions with species-specific versions of other subunits.

Conservation of Key Functional Domains in MT-ATP6 Across Species

Functional DomainConservation LevelFunctional SignificanceResearch Applications
Proton Channel PathHighly conservedEssential for proton translocation from intermembrane space to matrix Target for site-directed mutagenesis to study proton transport mechanisms
Subunit Interaction InterfacesModerately conservedRequired for proper assembly and stability of ATP synthase complex Analysis of species-specific adaptations in complex assembly
N163 and Surrounding RegionHighly conservedCritical for function; mutation site in mouse model (N163S) with pathological effects Model for studying disease-causing mutations across species
Oligomerization DomainsVariably conservedInvolved in dimer/oligomer formation affecting cristae morphology Comparative studies of mitochondrial ultrastructure evolution

Experimental Parameters for Functional Assessment of Recombinant MT-ATP6

ParameterMeasurement MethodExpected Results (Wild-type)Pathological Variation
ATP Synthesis RateLuciferase-based ATP quantificationSpecies-specific baseline ratesReduced in functional mutations
Proton TransportpH-sensitive fluorescent dyesEfficient proton translocationImpaired in channel-disrupting mutations
ROS GenerationFluorescent indicators (e.g., DCFDA)Low basal levelsIncreased in dysfunctional mutants
Mitochondrial Membrane PotentialVoltage-sensitive dyes (TMRM, JC-1)Stable potentialAltered in proton channel mutations
Complex AssemblyBN-PAGE or CN-PAGE analysisFully assembled complex V (approximately 597 kDa) Subcomplex formation (approximately 550 kDa in a/A6L absence)

How can platypus MT-ATP6 contribute to evolutionary studies of mitochondrial function?

As a monotreme, the platypus occupies a unique evolutionary position between reptiles and therian mammals. Comparative studies of platypus MT-ATP6 with those from other vertebrates can reveal the trajectory of mitochondrial evolution across major evolutionary transitions. Researchers can employ phylogenetic analysis combined with functional studies to determine which aspects of MT-ATP6 function have remained conserved and which have adapted to the specific metabolic demands of different lineages.

The unique ecological niche and physiological adaptations of the platypus provide context for understanding how mitochondrial function may have evolved to support its semi-aquatic lifestyle. Comparative analyses of MT-ATP6 from platypus and fully aquatic mammals could reveal convergent adaptations in energy production systems related to diving physiology and metabolic regulation.

Genomic approaches examining selection pressure on MT-ATP6 across species can identify regions under positive selection, potentially revealing adaptations to specific environmental challenges. These analyses can guide functional studies focusing on residues that may contribute to species-specific metabolic adaptations.

What therapeutic implications emerge from comparative studies of MT-ATP6 across species?

Research on platypus MT-ATP6 can identify evolutionarily conserved domains that might represent critical targets for therapeutic interventions in mitochondrial disorders. Residues or structural features conserved from platypus to humans likely serve essential functions that cannot tolerate modification, potentially representing vulnerable points for targeted therapies.

The observed relationship between ATP synthase dysfunction and reduced tumorigenic potential provides a foundation for exploring novel cancer therapeutic strategies . By understanding how specific mutations in MT-ATP6 affect cancer-related phenotypes across species, researchers can identify conserved mechanisms that might be exploited for therapeutic development.

Comparative studies can guide the development of genetic therapeutic approaches, such as gene replacement or editing strategies for MT-ATP6-related disorders. Understanding the functional consequences of specific mutations across species can help predict the effectiveness and potential side effects of such interventions in humans.

What emerging technologies will advance platypus MT-ATP6 research?

Cryo-electron microscopy (cryo-EM) represents a powerful approach for resolving the structure of membrane protein complexes without crystallization. Applied to ATP synthase containing platypus MT-ATP6, this technique could reveal species-specific structural adaptations at near-atomic resolution.

CRISPR-based mitochondrial DNA editing technologies, though still developing, may eventually allow direct manipulation of MT-ATP6 in living cells. This approach would enable precise introduction of mutations or evolutionary variants to study their functional consequences in the native cellular environment.

Organoid systems derived from diverse species, including potentially platypus, could provide physiologically relevant models for studying MT-ATP6 function in tissue-specific contexts. These three-dimensional culture systems better recapitulate the complexity of tissue environments compared to traditional cell culture.

Single-cell omics technologies can reveal cell-to-cell variation in mitochondrial function related to MT-ATP6 variants. This approach could identify subpopulations particularly vulnerable to ATP synthase dysfunction, providing insights into the tissue-specific manifestations of mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.