Recombinant Ornithorhynchus anatinus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Ornithorhynchus anatinus (Duckbill platypus)
Target Names
Target Protein Sequence
MAYPLQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISTMLTTKLTHTNTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPNLTIKTLGHQWYWSYEYSDYEDLSFDS YMIPTQDLLPGQLRLLEVDNHLVLPIELPIRMLISSEDVLHSWALPSMGLKTDAIPGRLN QATITSTRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWTSSMMSTS
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, formed by heme A3 and CuB. The BNC utilizes four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Ornithorhynchus anatinus Cytochrome c oxidase subunit 2 (MT-CO2)?

Ornithorhynchus anatinus Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein component of cytochrome c oxidase (COX), which serves as the terminal enzyme in the electron transport chain. The recombinant form, as described in commercial catalogs, typically consists of the full-length (1-230 amino acid) protein sequence, often fused with a histidine tag to facilitate purification . The protein plays a crucial role in transferring electrons from cytochrome c to molecular oxygen during oxidative phosphorylation, contributing to ATP production.

How does MT-CO2 contribute to the electron transport chain?

MT-CO2 is directly involved in the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for the production of ATP during cellular respiration . The protein contains specialized domains that facilitate this electron transfer process. As a component of Complex IV (cytochrome c oxidase), it represents the final step in the electron transport chain where electrons are ultimately transferred to molecular oxygen, reducing it to water. The process generates a proton gradient across the inner mitochondrial membrane that drives ATP synthesis .

What expression systems are optimal for recombinant platypus MT-CO2?

Recombinant platypus MT-CO2 is typically expressed in prokaryotic systems like Escherichia coli, as evident from commercial product descriptions . For research purposes, expression can be optimized using:

Expression SystemAdvantagesLimitationsReported Yield
E. coli BL21(DE3)Cost-effective, high yieldLack of post-translational modifications10-15 mg/L culture
Insect cells (Sf9)Better folding, some post-translational modificationsHigher cost, longer production time2-5 mg/L culture
Mammalian cells (HEK293)Native-like folding and modificationsHighest cost, lowest yield0.5-2 mg/L culture

When expressing in E. coli, consider using specialized strains for membrane proteins or those optimized for rare codon usage in platypus genes.

What purification strategies yield highest purity recombinant MT-CO2?

Purification of recombinant platypus MT-CO2 typically employs affinity chromatography when the protein is expressed with tags such as His-tag . A recommended purification workflow includes:

  • Initial clarification of cell lysate by centrifugation at 20,000×g

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Ion-exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing

  • Concentration using ultrafiltration (10 kDa MWCO)

Final product should achieve >90% purity as determined by SDS-PAGE and can be verified by Western blot using anti-MT-CO2 antibodies .

What methods are available for quantifying MT-CO2 activity?

Several approaches can be used to measure MT-CO2 activity, ranging from biochemical to histochemical methods:

  • Spectrophotometric Assays: Tracking the oxidation of reduced cytochrome c at 550 nm to measure electron transfer rates.

  • Polarographic Measurements: Using oxygen electrodes to measure oxygen consumption rates.

  • Histochemical Analysis: A sophisticated method has been developed that allows quantification of cytochrome c oxidase activity in tissue sections by directly relating optical density (OD) measurements to enzyme concentration. This technique uses a standard curve created with purified bovine heart cytochrome oxidase (ranging from 0.1 to 2 micrograms) affixed to nitrocellulose membranes . This method can detect optical density changes as small as 5% and correlate them with known concentrations of the enzyme.

  • Coupled Enzyme Assays: Linking MT-CO2 activity to other detectable reactions, particularly valuable when studying the protein in context of the entire cytochrome c oxidase complex.

How can structural features of platypus MT-CO2 be characterized?

Structural characterization of platypus MT-CO2 can be achieved through multiple complementary approaches:

TechniqueInformation ObtainedResolutionSample Requirements
X-ray CrystallographyHigh-resolution 3D structure1.5-3.0 Å5-10 mg purified protein
Cryo-EM3D structure, conformational states2.5-4.0 Å1-3 mg purified protein
Circular DichroismSecondary structure contentLow0.1-0.5 mg/ml solution
FTIR SpectroscopySecondary structure, cofactor bindingModerate1-2 mg lyophilized sample
NMR SpectroscopyDynamic structural informationHigh (for specific regions)15N/13C-labeled protein

When analyzing membrane proteins like MT-CO2, consider incorporating the protein into nanodiscs or liposomes to maintain native-like environments during structural studies.

How does platypus MT-CO2 compare evolutionarily to other species?

Platypus (Ornithorhynchus anatinus) MT-CO2 represents a unique evolutionary position as monotremes diverged early in mammalian evolution. Comparison with other species reveals:

  • Conservation Patterns: Despite the integral role of cytochrome c oxidase in electron transport, studies of similar proteins (like COII in marine copepods) have shown extensive intraspecific nucleotide and amino acid variation, reaching nearly 20% at the nucleotide level between populations . This suggests potential for variation in platypus MT-CO2 across different geographical areas.

  • Selection Pressure: Most codons in cytochrome oxidase genes are under strong purifying selection (ω << 1), with approximately 4% of sites evolving under relaxed selective constraint (ω = 1) . This pattern likely applies to platypus MT-CO2 as well.

  • Functional Domains: The electron transfer functions have maintained high conservation in key functional domains across species, particularly at sites responsible for interaction with cytochrome c and other subunits of the cytochrome c oxidase complex.

What insights can platypus MT-CO2 provide about mitochondrial evolution?

Studying platypus MT-CO2 offers unique perspectives on mitochondrial evolution:

  • Monotremes represent an early branch in mammalian evolution, making their mitochondrial genes valuable for understanding the ancestral state of mammalian mitochondrial proteins.

  • Analysis of platypus MT-CO2 can help identify sites experiencing positive selection that may have contributed to adaptation to different metabolic demands or environmental conditions.

  • Unlike cytochrome c oxidase subunit-1 (MT-CO1), which is widely used for animal barcoding, MT-CO2 may offer alternative evolutionary insights for certain species comparisons .

  • Comparative studies of platypus MT-CO2 with other monotremes, marsupials, and placental mammals can help reconstruct the evolutionary history of mitochondrial electron transport chain components.

How can recombinant MT-CO2 be used to study mitochondrial dysfunction?

Recombinant platypus MT-CO2 can serve as a valuable tool for investigating mitochondrial dysfunction:

  • Oxidative Stress Studies: Cytochrome c oxidase dysfunction is invariably associated with increased mitochondrial reactive oxygen species (ROS) production and cellular toxicity . Recombinant MT-CO2 can be used in reconstitution experiments to study how specific mutations or modifications affect ROS production.

  • Disease Modeling: Using site-directed mutagenesis to introduce disease-associated mutations found in human MT-CO2 into the platypus homolog can provide evolutionary context for pathogenic mutations.

  • Bioenergetic Analysis: Incorporation of recombinant MT-CO2 into liposomes or nanodiscs allows measurement of proton pumping efficiency and electron transfer rates under controlled conditions.

  • Protein-Protein Interaction Studies: Pull-down assays using tagged MT-CO2 can identify interaction partners, including nuclear-encoded subunits that must coordinate with mitochondrial-encoded components for proper assembly and function.

What role does MT-CO2 play in cellular respiration and oxidative stress?

MT-CO2 functions within the cytochrome c oxidase complex, which:

  • Handles more than 90% of molecular oxygen respired by mammalian cells and tissues .

  • Serves as a critical regulatory point for mitochondrial oxidative metabolism and ATP synthesis, acting as a "pace setter" for these processes .

  • Influences reactive oxygen species (ROS) production, though its direct role remains debated. Evidence suggests that cytochrome c oxidase dysfunction consistently leads to increased mitochondrial ROS generation and cellular toxicity .

  • Can be affected by various pathological factors leading to dysfunction through mechanisms including:

    • Assembly defects

    • Covalent modifications and loss of subunits

    • Disassembly of supercomplex organization

    • Direct inhibition of enzyme activity

These dysfunctions ultimately result in energy deficits (reduced ATP), lactic acidosis, and increased ROS formation.

What controls are essential when working with recombinant platypus MT-CO2?

When designing experiments with recombinant platypus MT-CO2, include these critical controls:

  • Protein Quality Controls:

    • SDS-PAGE analysis to confirm purity (should be >90%)

    • Western blot verification using anti-MT-CO2 antibodies

    • Mass spectrometry to confirm amino acid sequence integrity

  • Functional Controls:

    • Comparison with commercially available bovine heart cytochrome c oxidase as activity reference

    • Heat-denatured MT-CO2 as negative control

    • Human MT-CO2 as comparative reference

  • Experimental System Controls:

    • Empty vector-expressed and purified samples to control for host cell protein contamination

    • Endotoxin testing (<1 EU/µg) for experiments involving cellular systems

    • Buffer-only controls for spectroscopic measurements

How can the activity of recombinant MT-CO2 be optimized in experimental systems?

Optimizing recombinant platypus MT-CO2 activity requires attention to several factors:

ParameterOptimal ConditionEffect on Activity
pH7.2-7.4Maximum electron transfer efficiency
Temperature33-37°CReflects mammalian physiological range
Ionic Strength100-150 mM KClMaintains protein stability and substrate binding
Lipid EnvironmentCardiolipin-enrichedEnhances stability and electron transfer
Detergent0.5% Tween 80Maintains solubility without denaturing
Reducing Agents1 mM sodium ascorbateMaintains reduced state for functional studies

When conducting stopped-flow experiments to study electron transfer kinetics, careful degassing and equilibration with nitrogen is essential before full reduction with sodium ascorbate . Additionally, experiments tracking CO binding to the reduced enzyme can provide insights into the functional state of the cytochrome c oxidase complex.

What are common pitfalls when working with recombinant MT-CO2?

Several challenges may arise when working with recombinant platypus MT-CO2:

  • Low Expression Yields: MT-CO2 is a membrane protein that may form inclusion bodies in bacterial expression systems. Consider:

    • Lowering induction temperature to 16-18°C

    • Using specialized E. coli strains like C41(DE3) or C43(DE3)

    • Adding membrane-mimicking detergents to culture media

  • Protein Instability: Purified MT-CO2 may quickly lose activity. Address by:

    • Adding glycerol (5-50%) to storage buffer

    • Aliquoting and storing at -80°C to avoid freeze-thaw cycles

    • Using trehalose (6%) in storage buffer as mentioned in commercial preparations

  • Activity Measurement Interference: Background absorption or oxygen consumption can confound results. Mitigate by:

    • Careful blank corrections in spectrophotometric assays

    • Using multiple wavelengths (e.g., 585 nm) to track reactions

    • Accounting for contribution of cytochrome c oxidation (~30% of total absorbance at 585 nm)

  • Reconstitution Challenges: When incorporating MT-CO2 into liposomes or studying it within the complete cytochrome c oxidase complex, difficulties in achieving native-like activity may occur. Consider step-wise assembly protocols and validation with known activity markers.

How can recombinant MT-CO2 activity be distinguished from endogenous cytochrome c oxidase activity?

When studying recombinant platypus MT-CO2 in experimental systems that may contain endogenous cytochrome c oxidase activity:

  • Specific Inhibition: Use inhibitors that differentially affect recombinant versus endogenous enzyme, such as specific antibodies against unique epitopes in platypus MT-CO2.

  • Tag-Based Approaches: Utilize the His-tag or other fusion tags on recombinant MT-CO2 to:

    • Selectively immobilize the recombinant protein

    • Detect activity through tag-specific antibodies in immunohistochemistry

    • Separate activities through pull-down assays

  • Spectral Properties: Exploit subtle differences in absorption spectra between platypus and other species' cytochrome c oxidase to distinguish activities.

  • Kinetic Analysis: Compare kinetic parameters (Km, Vmax) which may differ between recombinant platypus MT-CO2 and endogenous enzyme from experimental systems.

  • Temperature Sensitivity: Determine and utilize differences in thermal stability between the recombinant and endogenous enzymes to selectively measure one versus the other.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.