Recombinant Ornithorhynchus anatinus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

MT-ND6 is a core subunit of mitochondrial Complex I (NADH dehydrogenase), which catalyzes electron transfer from NADH to ubiquinone in the respiratory chain . The recombinant platypus MT-ND6 retains this function and is expressed in heterologous systems like E. coli for experimental use . Key features include:

  • Gene Location: Encoded on the L-strand of mitochondrial DNA .

  • Protein Structure: 166 amino acids (18 kDa) with a hydrophobic transmembrane domain critical for electron transport .

  • Catalytic Role: Facilitates NADH oxidation and proton pumping across the mitochondrial membrane .

Production and Purification

Recombinant MT-ND6 is synthesized using various expression platforms. Data from suppliers indicate the following production methods:

Expression SystemProduct Code (CUSABIO)PurityTag
E. coli (full-length)CSB-CF653587OEX≥85% (SDS-PAGE)N-terminal His tag
Yeast/BaculovirusCSB-EP653587OEX1≥90%None/Partial

The protein is typically stored in Tris/PBS-based buffers with glycerol and lyophilized for stability .

Disease Modeling

Mutations in MT-ND6 are linked to mitochondrial disorders such as:

  • Leber’s hereditary optic neuropathy (LHON): Impaired Complex I activity disrupts ATP synthesis .

  • Leigh’s syndrome: The G14459A mutation (Ala72Val) compromises electron transport, leading to neurodegeneration .

  • Dystonia: Altered proton gradient generation affects neuronal signaling .

Recombinant MT-ND6 enables in vitro studies of these mutations’ structural and functional impacts .

Comparative Biology

The platypus MT-ND6 sequence (UniProt: Q36460) shares evolutionary insights with homologs in:

  • Zebrafish (Danio rerio): Antibody CSB-PA878730XA01DIL cross-reacts with zebrafish MT-ND6 .

  • Echidna (Tachyglossus aculeatus): Recombinant proteins highlight conserved regions across monotremes .

Technical Considerations

  • Storage: Recombinant MT-ND6 is stable at -80°C but degrades upon repeated freeze-thaw cycles .

  • Activity Validation: Requires functional assays measuring NADH oxidation rates or ubiquinone reduction .

  • Species Specificity: Antibodies against human MT-ND6 (e.g., CSB-PA229750) may not cross-react with platypus variants .

Future Directions

Ongoing research focuses on:

  • Engineering thermostable MT-ND6 variants for crystallography .

  • Screening small molecules to restore Complex I function in LHON models .

  • Phylogenetic analysis of MT-ND6 across monotremes and marsupials .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted to meet customer needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Ornithorhynchus anatinus (Duckbill platypus)
Target Names
Target Protein Sequence
MMYFVYLLSILLVLGFMAFASKPSPIYGGLSLVLSGGVGCGIVVSLGGSFLGLIVFLVYL GGMLVVFGYTAAMATEEYPETWVDSTVFTNLLIMVGMLGVIWYYFSGEVDLSINYDLLDL GGVEVLGGDYNGVSLLSACGGWELIFSGWILFLTIFVVLEVTRGEH
Uniprot No.

Target Background

Function

Function: A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. It is essential for the catalytic activity and assembly of Complex I.

Database Links
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND6 and what is its functional significance in mitochondrial research?

MT-ND6 (Mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 6) is an essential component of the mitochondrial respiratory chain Complex I. This protein is involved in the first step of the electron transport chain, facilitating proton translocation across the inner mitochondrial membrane. In experimental contexts, researchers often focus on MT-ND6 because it forms part of the fourth E-channel responsible for proton translocation within the transmembrane domain of Complex I, interacting with ND1 and ND4L subunits .

The functional significance of MT-ND6 extends beyond basic energy production, as mutations in this gene have been associated with mitochondrial disorders in humans, including Leber's hereditary optic neuropathy (LHON) . Studying platypus MT-ND6 offers unique evolutionary perspectives due to the monotreme's position in mammalian phylogeny.

How can researchers isolate mitochondrial DNA containing the MT-ND6 gene from platypus tissues?

Isolation of mitochondrial DNA containing MT-ND6 from platypus tissues follows protocols similar to those used for other species, with some modifications to account for tissue-specific characteristics. The most effective method involves:

  • Tissue homogenization followed by differential centrifugation to isolate intact mitochondria

  • Removal of nuclei and cellular debris through low-speed centrifugation

  • Pelleting of mitochondria through higher-speed centrifugation

  • Alkaline lysis of mitochondria followed by phenol/chloroform extraction

For platypus tissues, liver samples typically yield the highest quality and quantity of mtDNA. Following isolation, restriction enzyme digestion (using enzymes such as ApaI and HindIII) can be performed to generate fragments suitable for cloning . Alternatively, direct PCR amplification of the MT-ND6 region can be performed using specific primers designed based on the published platypus mitochondrial genome sequence.

What sequence conservation patterns are observed in platypus MT-ND6 compared to other species?

Sequence analysis of platypus MT-ND6 reveals important conservation patterns that reflect functional constraints on this protein. While specific amino acid positions show high conservation across vertebrates (similar to the conservation of proline at position 79 in human ND6 ), platypus MT-ND6 exhibits some unique features reflecting its evolutionary history.

The conservation analysis is particularly important when investigating potentially pathogenic variants. In human studies, certain MT-ND6 variants initially weren't recognized as pathogenic due to low phylogenetic conservation of affected amino acids . This underscores the importance of comprehensive comparative analysis when studying platypus MT-ND6 variants.

When analyzing conservation patterns, researchers should:

  • Perform multiple sequence alignments across diverse taxa

  • Focus on transmembrane domains and functional regions

  • Consider both amino acid identity and similarity

  • Evaluate conservation in the context of known functional domains

How can CRISPR-Cas9 gene editing be applied to study platypus MT-ND6 function?

CRISPR-Cas9 technology offers powerful approaches for functional analysis of MT-ND6, though direct editing of mitochondrial DNA remains challenging. For platypus MT-ND6 studies, researchers can apply strategies like those used in human cell studies:

  • Create cell models with conditional knockouts of nuclear factors essential for mtDNA maintenance and expression

  • Establish GeneSwap approaches where endogenous genes are replaced with variant forms

  • Design systems to study the consequences of MT-ND6 variants in cellular contexts

The GeneSwap approach is particularly valuable, as demonstrated in human studies where researchers established osteosarcoma cell lines (143B#6) with TFAM GeneSwap capabilities . For platypus MT-ND6, this would involve:

  • Creating knockout cells lacking functional MT-ND6

  • Rescuing with wild-type MT-ND6 flanked by recombinase target sites

  • Introducing variant forms of MT-ND6 to study functional consequences

While direct CRISPR editing of mitochondrial DNA remains challenging, these nuclear-based approaches provide viable alternatives for functional studies.

What are the technical considerations for creating cybrid cell lines to study platypus MT-ND6?

Cybrid (cytoplasmic hybrid) cell lines represent a gold standard approach for studying mitochondrial gene function and pathogenicity of mtDNA variants. Creating cybrid lines for platypus MT-ND6 research involves several critical steps:

  • Obtaining recipient ρ⁰ cells (cells devoid of mtDNA) through ethidium bromide treatment or other methods

  • Isolating platelets or enucleated cells containing platypus mitochondria

  • Performing cell fusion using polyethylene glycol (PEG-1450) or similar fusion agents

  • Selecting for successful cybrids using media without uridine and pyruvate (-UP medium)

Technical considerations specific to platypus MT-ND6 studies include:

  • Ensuring compatibility between nuclear and mitochondrial components

  • Validating cybrids through PCR confirmation of mtDNA presence

  • Confirming expression of platypus mitochondrial genes through RT-qPCR

  • Assessing respiratory chain complex activities, particularly Complex I

Fusion protocols typically involve exposing co-plated cells to a sterile solution containing approximately 4.7g polyethyleneglycol-1450, 4mL unsupplemented medium, and 1mL DMSO for about 1 minute, followed by washing and selection in appropriate media .

How can researchers differentiate between pathogenic and non-pathogenic variants in platypus MT-ND6?

Distinguishing pathogenic from non-pathogenic variants in platypus MT-ND6 requires multiple lines of evidence:

  • Evolutionary conservation analysis across species

  • Functional studies in cellular models

  • Biochemical assessment of respiratory chain complex activities

  • In silico prediction of structural and functional impacts

Cybrid studies are particularly valuable for establishing pathogenicity. For example, in human studies, the m.14439G>A MT-ND6 variant was confirmed as pathogenic while the m.1356A>G variant was identified as a non-pathogenic polymorphism through cybrid analysis .

For platypus MT-ND6 variants, researchers should:

  • Create cybrid cell lines containing the variant mtDNA

  • Measure Complex I-dependent respiratory activity

  • Assess oxidative phosphorylation capacity

  • Compare results with wild-type controls

  • Consider combinations of variants that may collectively impact function

An important consideration is that some variants may only be pathogenic in particular combinations or on specific haplogroup backgrounds, as demonstrated in human LHON studies where certain MT-ND6 variants only cause disease when present in specific combinations .

What are the optimal expression systems for recombinant platypus MT-ND6 production?

Expressing recombinant platypus MT-ND6 presents significant challenges due to its hydrophobic nature and mitochondrial localization. Researchers have several options:

  • Bacterial expression systems using specialized strains designed for membrane proteins

  • Yeast expression systems that provide a eukaryotic environment

  • Mammalian cell expression using retroviral transduction

  • Cell-free expression systems for difficult membrane proteins

For retroviral transduction approaches, researchers can adopt protocols similar to those used in human studies:

  • Seed recipient cells at 20-40% confluence

  • Replace medium with a mixture of fresh medium and retroviral supernatant supplemented with polybrene (10 μg/mL)

  • Incubate overnight, replace medium, and continue incubation for 24 hours

  • Dissociate cells and plate at different dilutions in selective medium

When expressing MT-ND6 constructs, it's essential to include appropriate mitochondrial targeting sequences (MTS) to ensure proper localization. Validation of mitochondrial targeting can be performed by fusing the MT-ND6 MTS with reporter proteins like EGFP and confirming co-localization with mitochondrial markers such as MitoTracker Red CMXRos .

What PCR and sequencing strategies are most effective for platypus MT-ND6 amplification and analysis?

Effective amplification and sequencing of platypus MT-ND6 requires specialized approaches:

  • Long-range PCR for amplifying complete mitochondrial regions:

    • Use high-fidelity polymerases designed for long amplicons

    • Implement touchdown PCR protocols with extension times appropriate for fragment length

    • Follow programs such as: 2 min at 94°C, followed by 10 cycles of 10s at 94°C, 30s at 58°C, and 4 min at 68°C, then 20 cycles with increasing extension times

  • Sequencing strategies:

    • Employ overlapping fragments with approximately 100bp overlap between contigs

    • Use both universal primers and gene-specific primers designed for platypus mtDNA

    • Apply automated DNA sequencer technology with fluorescent dye terminator chemistry

  • Validation approaches:

    • Restriction Fragment Length Polymorphism (RFLP) analysis for variant confirmation

    • Cloning of PCR products into appropriate vectors (pGEM-T or similar)

    • Bidirectional sequencing to ensure accuracy

For challenging regions with secondary structure, additives such as DMSO or betaine may improve amplification efficiency. Nested PCR approaches can also be effective for obtaining specific amplification of MT-ND6 from total mtDNA preparations.

How can researchers assess the functional impact of MT-ND6 variants on mitochondrial complex I activity?

Functional assessment of MT-ND6 variants requires multiple complementary approaches:

  • Respiratory enzyme assays:

    • Measure NADH:ubiquinone oxidoreductase activity in isolated mitochondria or permeabilized cells

    • Compare activity ratios relative to other respiratory chain complexes

    • Assess activity in both tissue samples and cellular models

  • Oxygen consumption measurements:

    • Utilize platforms like Seahorse XF analyzers to measure oxygen consumption rates

    • Assess basal respiration, maximal respiration, and spare respiratory capacity

    • Evaluate substrate-specific responses using complex I-dependent substrates

  • ROS production assessment:

    • Measure superoxide and hydrogen peroxide production

    • Evaluate oxidative stress markers in cells expressing variant MT-ND6

    • Assess antioxidant responses

  • Mitochondrial membrane potential analysis:

    • Use potentiometric dyes to evaluate proton pumping capacity

    • Assess impact of variants on membrane potential maintenance

    • Evaluate relationship between complex I activity and membrane potential

For definitive assessment, cybrid studies remain the gold standard, allowing researchers to evaluate the impact of MT-ND6 variants in a controlled nuclear background .

How should researchers analyze combinations of MT-ND6 variants that may collectively impact function?

Analysis of multiple co-occurring variants in MT-ND6 presents unique challenges, as demonstrated in human studies where combinations of individually non-pathogenic variants can collectively cause disease . For platypus MT-ND6 research, consider:

  • Haplotype analysis:

    • Evaluate complete mitochondrial haplotypes rather than individual variants

    • Assess frequency of variant combinations in population samples

    • Determine whether certain variant combinations are unique to specific lineages

  • Structural modeling:

    • Map variants onto predicted 3D structures of Complex I

    • Analyze clustering of variants in functional domains like the E-channel

    • Evaluate potential interactions between amino acid changes

  • Statistical approaches:

    • Apply algorithms for detecting epistatic interactions between variants

    • Use machine learning methods to identify patterns in variant combinations

    • Develop predictive models for functional impact based on variant combinations

Evidence from human studies indicates that certain MT-ND6 variants only become pathogenic in specific combinations. For example, combinations of m.14258G>A, m.14582A>G, and m.10680G>A variants in human MT-ND6 were associated with LHON despite being individually classified as non-pathogenic .

What approaches can resolve contradictory findings in MT-ND6 functional studies?

Contradictory findings are common in mitochondrial research due to factors like nuclear-mitochondrial interactions, haplogroup effects, and methodological differences. Strategies to resolve contradictions include:

  • Standardized methodology:

    • Establish consensus protocols for functional assessments

    • Report detailed experimental conditions including media composition, cell density, and passage number

    • Analyze multiple parameters of mitochondrial function rather than single endpoints

  • Multiple model systems:

    • Compare results across different cell types and model organisms

    • Validate findings in primary cells versus established cell lines

    • Consider species-specific differences in nuclear-mitochondrial interactions

  • Comprehensive genetic analysis:

    • Sequence complete mitochondrial genomes rather than single genes

    • Consider nuclear genetic background effects

    • Evaluate potential compensatory mechanisms

  • Meta-analysis approaches:

    • Systematically review published findings

    • Apply statistical methods to reconcile divergent results

    • Identify factors that may explain inconsistencies between studies

When contradictory findings emerge, cybrid studies with carefully controlled nuclear backgrounds provide a powerful approach to determine whether MT-ND6 variants directly impact mitochondrial function .

How can evolutionary analysis inform functional studies of platypus MT-ND6?

Evolutionary analysis provides crucial context for interpreting functional studies of platypus MT-ND6:

  • Comparative genomics approaches:

    • Align MT-ND6 sequences across diverse taxa including monotremes, marsupials, and placental mammals

    • Identify lineage-specific changes versus universally conserved residues

    • Calculate evolutionary rates for different domains and functional regions

  • Selection analysis:

    • Apply tests for positive selection and functional constraint

    • Identify sites under different selective pressures

    • Correlate evolutionary patterns with functional domains

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences at key evolutionary nodes

    • Experimentally test reconstructed ancestral proteins

    • Evaluate functional shifts during monotreme evolution

Evolutionary insights are particularly valuable when classifying variants, as demonstrated in human studies where certain MT-ND6 variants initially considered pathogenic were later recognized as haplogroup markers . For platypus MT-ND6, understanding the evolutionary context is essential for distinguishing functionally significant variants from neutral polymorphisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.