Recombinant Orycteropus afer Alpha-2B adrenergic receptor (ADRA2B)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant ADRA2B is a full-length, N-terminal His-tagged protein expressed in E. coli. It corresponds to the 1–388 amino acid sequence of the aardvark α2B-AR (UniProt ID: O19032) and is provided as a lyophilized powder with >90% purity (SDS-PAGE verified) .

3.1. In Vitro Studies

  • Receptor-Ligand Interaction Assays: Used to screen α2B-AR agonists/antagonists via SDS-PAGE and ELISA .

  • Signal Transduction Analysis: Investigates MAPK/ERK pathways, which α2B-AR activates via Gαi/o proteins .

Biochemical Pathways

ADRA2B participates in several signaling cascades:

PathwayAssociated Proteins/Processes
Gαi SignalingInhibition of cAMP, activation of ERK1/2
Sympathetic RegulationNorepinephrine release, blood pressure modulation
Inflammatory ResponseTLR2/4 and IL-6 upregulation

Comparative Insights

  • Species-Specific Pharmacology: Rodent α2A-AR (classified as α2D) shows distinct ligand affinity compared to human α2A-AR, highlighting the need for species-specific reagents like aardvark ADRA2B .

  • Therapeutic Targeting: α2B-AR antagonists (e.g., BRL 44408) show efficacy in preclinical models of infection and colitis .

Limitations and Considerations

  • Species Relevance: Aardvark ADRA2B may differ in ligand specificity from human or rodent orthologs.

  • Functional Assays: Requires reconstitution in lipid membranes for native-like activity .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Please note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you require a specific tag type, please inform us, and we will prioritize developing it for your order.
Synonyms
ADRA2B; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Orycteropus afer (Aardvark)
Target Names
Target Protein Sequence
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRXIKCII LTVWLIAAAISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILSSSIGSFFAPCLIMILVYL RIYVIAKRSNRRGPRAKGASREGKSKQPHPFPAGASSARPPTLTSSLAVAGEANGHSKPT GEKEGKTPEDPGTLTLPPSWPAFPNSGEGQKEGICGTSPEEEAEEEEEECEPQAAPASSA SACNPPLQQPQGSRVLATLRGQVLLGRGLGAAGGQWWRRRAQLTREKRFTFVLAVVIGVF VLCWFPFFFSYSLGAICPQRCKVPHGLF
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the inhibition of adenylate cyclase through the action of G proteins in response to catecholamine stimulation.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the standard specifications for commercially available recombinant ADRA2B?

Commercially available recombinant Orycteropus afer ADRA2B typically has the following specifications:

ParameterSpecification
SpeciesOrycteropus afer (Aardvark)
Protein LengthFull Length (1-388 amino acids)
Expression SystemE. coli
TagN-terminal His
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ApplicationsSDS-PAGE and other analytical methods

These specifications ensure consistent quality for research applications requiring standardized protein samples .

What are the optimal storage conditions for maintaining ADRA2B stability?

For optimal stability of recombinant ADRA2B:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For extended storage, keep reconstituted protein with added glycerol at -20°C or -80°C

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

How should ADRA2B be reconstituted for optimal experimental use?

The recommended reconstitution procedure is:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is typically recommended)

  • Gently mix until completely dissolved

  • Aliquot the reconstituted protein to minimize future freeze-thaw cycles

This methodology ensures maximum protein stability and activity for downstream experimental applications .

What analytical techniques are most effective for characterizing recombinant ADRA2B?

For comprehensive characterization of recombinant ADRA2B, implement the following analytical techniques:

  • SDS-PAGE Analysis:

    • Run samples on 10-12% polyacrylamide gels

    • Expected molecular weight: approximately 43 kDa plus tag contribution

    • Assess purity through densitometric analysis (target >90% purity)

  • Western Blotting:

    • Use anti-His tag antibodies or specific anti-ADRA2B antibodies

    • Confirm specific detection at the expected molecular weight

    • Evaluate potential degradation products or aggregates

  • Mass Spectrometry:

    • Perform tryptic digest followed by LC-MS/MS analysis

    • Confirm protein identity through peptide mass fingerprinting

    • Identify potential post-translational modifications

  • Size Exclusion Chromatography:

    • Assess oligomeric state and sample homogeneity

    • Monitor for aggregation or degradation

These methods collectively provide a comprehensive profile of protein quality essential for reliable experimental outcomes .

How can researchers optimize functional assays using recombinant ADRA2B?

When designing functional assays with recombinant ADRA2B, consider the following methodological approach:

  • Receptor Binding Assays:

    • Use radiolabeled alpha-2 adrenergic ligands (e.g., [³H]-yohimbine)

    • Include proper controls for non-specific binding

    • Optimize protein:ligand ratio for maximum signal-to-noise ratio

    • Consider detergent effects on binding properties

  • G-Protein Coupling Assays:

    • For E. coli-expressed protein, reconstitution into liposomes may be necessary

    • Measure GTPγS binding as an indicator of receptor activation

    • Include positive controls with known agonists

  • Structural Stability Assessments:

    • Use circular dichroism (CD) to verify secondary structure integrity

    • Implement thermal shift assays to identify stabilizing conditions

    • Monitor stability over time under various storage conditions

  • Data Analysis Considerations:

    • Account for protein purity when calculating binding parameters

    • Apply appropriate mathematical models for binding kinetics

    • Consider species-specific differences when comparing to human ADRA2B

These methodological considerations help ensure reliable and reproducible functional data when working with recombinant ADRA2B .

How is ADRA2B used as a molecular marker in evolutionary studies?

The ADRA2B gene serves as a valuable molecular marker in evolutionary studies due to several key characteristics:

  • Phylogenetic Utility:

    • Being an intronless nuclear gene, ADRA2B simplifies sequence analysis

    • Contains sufficient phylogenetic signal for resolving relationships within and between mammalian orders

    • When combined with other nuclear genes like vWF and IRBP, provides robust phylogenetic resolution

  • Methodological Approach:

    • Extract genomic DNA from tissue samples

    • Amplify ADRA2B using PCR with primers designed for conserved regions

    • Sequence amplicons using Sanger or next-generation sequencing

    • Align sequences and construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Implement molecular clock analyses for divergence time estimation

  • Application in Mammalian Phylogeny:

    • The Orycteropus afer (aardvark) ADRA2B sequence represents the order Tubulidentata

    • Inclusion of this taxon helps resolve deep mammalian relationships

    • Has been used in studies investigating the arrival and diversification of various mammalian groups

This approach has successfully resolved complex evolutionary questions, such as the timing of diversification of Caviomorph rodents and Platyrrhine primates in South America .

What insights can comparative analysis of ADRA2B across species provide?

Comparative analysis of ADRA2B across mammalian species offers valuable insights into:

  • Functional Conservation:

    • Identify highly conserved domains crucial for receptor function

    • Map species-specific variations that might reflect adaptive changes

    • Correlate sequence conservation with known functional domains

  • Evolutionary Rates:

    • Calculate substitution rates to identify regions under purifying or positive selection

    • Compare evolutionary rates between ADRA2B and other adrenergic receptors

    • Detect lineage-specific accelerations in evolutionary rate

  • Methodological Approach for Comparative Analysis:

    • Retrieve ADRA2B sequences from diverse mammalian representatives

    • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Calculate sequence identity and similarity percentages

    • Generate conservation plots to visualize variability across the protein

    • Implement sliding window analysis to detect variable selection pressure

  • Research Applications:

    • Use comparative data to predict functional effects of species-specific variations

    • Design cross-species pharmacological studies to investigate receptor evolution

    • Inform structure-function relationship studies through evolutionary analysis

This comparative approach illuminates both evolutionary relationships and functional adaptations in adrenergic signaling pathways across mammals .

What are common challenges when working with recombinant ADRA2B and how can they be addressed?

Researchers commonly encounter these challenges when working with recombinant ADRA2B:

ChallengePossible CausesSolutions
Protein AggregationImproper folding, concentration too highOptimize detergent type/concentration, add stabilizing agents, maintain lower concentrations
Low Functional ActivityDenaturation during purification, improper foldingInclude ligands during purification, optimize refolding protocols, verify structure with CD spectroscopy
Proteolytic DegradationPresence of proteases, suboptimal buffer conditionsAdd protease inhibitors, optimize pH and buffer components, maintain cold temperatures
Batch-to-Batch VariabilityInconsistent expression/purificationStandardize protocols, implement rigorous QC steps, pool multiple expressions
Poor SolubilityHydrophobic nature of membrane proteinScreen different detergents, use fusion tags enhancing solubility, consider alternative expression systems

Addressing these challenges systematically improves experimental outcomes and data reliability when working with this challenging membrane protein .

How can ADRA2B be utilized in comparative receptor pharmacology studies?

To effectively use ADRA2B in comparative receptor pharmacology:

  • Cross-Species Binding Studies:

    • Compare binding profiles of the same ligands across ADRA2B from different species

    • Use consistent experimental conditions across all species variants

    • Determine species-specific pharmacological parameters (Ki, EC50, efficacy)

    • Correlate binding differences with sequence variations in binding pockets

  • Structure-Function Analysis:

    • Generate 3D structural models using homology modeling

    • Map sequence variations onto structural models to identify functionally important differences

    • Design mutagenesis experiments based on comparative sequence analysis

    • Test hypotheses about species-specific pharmacological profiles

  • Evolutionary Pharmacology Approach:

    • Trace the evolution of ligand binding sites across phylogenetic lineages

    • Identify convergent or divergent evolutionary patterns in receptor function

    • Correlate receptor evolution with environmental adaptations or physiological requirements

  • Data Interpretation Considerations:

    • Account for differences in post-translational modifications between recombinant and native proteins

    • Consider the influence of expression systems on receptor properties

    • Validate findings with multiple methodological approaches

This comprehensive approach yields valuable insights into receptor evolution and species-specific pharmacological properties with implications for drug discovery and evolutionary biology .

How can ADRA2B be used in conjunction with retinal photoreceptor studies?

Integrating ADRA2B research with retinal studies offers unique opportunities for understanding adrenergic signaling in visual systems:

  • Co-Expression Analysis:

    • Investigate co-localization of ADRA2B with retinal photoreceptor markers

    • Use immunofluorescence labeling techniques to map receptor distribution

    • Correlate expression patterns with functional photoreceptor types (rods vs. cones)

  • Methodological Approach:

    • Prepare retinal tissue sections using cryostat sectioning (typically 16 μm thickness)

    • Implement multiple immunofluorescence labeling for simultaneous visualization

    • Use specific antibodies against ADRA2B alongside photoreceptor markers

    • Analyze co-localization using confocal microscopy and image analysis software

  • Comparative Studies Across Species:

    • Compare ADRA2B expression patterns between diurnal and nocturnal species

    • Correlate receptor distribution with visual ecology and adaptation

    • Study the aardvark as a model for nocturnal adaptation in visual systems

  • Functional Integration:

    • Investigate the role of adrenergic signaling in modulating photoreceptor function

    • Study potential interactions between visual transduction and adrenergic pathways

    • Design experiments to test the effects of adrenergic stimulation on visual responses

This integrated approach provides comprehensive insights into the functional relationship between adrenergic signaling and visual processing across species with different visual adaptations .

What are the best practices for designing experiments that combine ADRA2B with studies of evolutionary adaptations?

When designing experiments that integrate ADRA2B with evolutionary adaptation studies:

  • Taxon Sampling Strategy:

    • Include representatives from diverse mammalian lineages

    • Prioritize species with different ecological niches or physiological adaptations

    • Consider convergent evolution scenarios to test adaptive hypotheses

  • Multi-Level Analysis Approach:

    • Sequence level: Compare coding sequences across species

    • Protein level: Analyze structural and functional conservation

    • Tissue level: Examine expression patterns and receptor distribution

    • Physiological level: Correlate receptor properties with organismal adaptations

  • Methodological Integration:

    • Combine molecular techniques (sequencing, recombinant expression) with physiological assays

    • Use pharmacological tools to probe functional variations between species

    • Implement statistical phylogenetic methods to detect selection signatures

    • Correlate molecular findings with ecological or physiological data

  • Experimental Design Considerations:

    • Include appropriate controls for phylogenetic non-independence

    • Account for differences in sample preservation and quality across species

    • Design experiments that can distinguish between neutral evolution and adaptation

    • Consider the effects of recombinant expression on native protein properties

By following these best practices, researchers can establish meaningful connections between molecular evolution of ADRA2B and adaptive phenotypes across mammalian lineages .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.