Recombinant Orycteropus afer Aquaporin-2 (AQP2)

Shipped with Ice Packs
In Stock

Description

Key Phosphorylation Sites

Phosphorylation at specific residues (e.g., Ser-256 in human AQP2) regulates water permeability and membrane trafficking . While direct data on Orycteropus afer AQP2 phosphorylation is limited, conserved residues likely govern similar mechanisms:

ResidueFunction in Human AQP2Potential Role in Orycteropus afer AQP2
Ser-256PKA-mediated phosphorylation increases water permeability Likely analogous regulatory site
Ser-261Modulates trafficking and membrane insertion May influence subcellular localization

Research Applications

Recombinant Orycteropus afer AQP2 is utilized in diverse studies:

Water Channel Function

  • Permeability Assays: Reconstituted into proteoliposomes to measure osmotic water flux, mimicking in vivo conditions .

  • Structural Insights: X-ray crystallography and biochemical assays to study gating mechanisms or ion binding (e.g., Ca²⁺) .

Trafficking and Regulation

  • Vasopressin Signaling: Models for studying AQP2 translocation to apical membranes in response to hormones .

  • Cytoskeletal Interactions: Role of actin and myosin in exocytosis/endocytosis .

Disease Modeling

  • Nephrogenic Diabetes Insipidus (NDI): Mutations in AQP2 cause misfolding/ER retention . Recombinant AQP2 helps study pathogenic mechanisms.

Challenges and Limitations

  • Species-Specific Differences: Structural divergences (e.g., loop regions) may affect functional outcomes compared to human AQP2 .

  • Limited Direct Studies: Most research focuses on human AQP2; Orycteropus afer AQP2 data are inferred from conserved domains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Orycteropus afer (Aardvark)
Target Names
AQP2
Target Protein Sequence
SIAFSKAVFSEFLATLLFVFFGLGSALNWPQALPSGLQIAMAFGLAIGTLVQTLGHISGAHINPAVTVACLVGCHVSFLRAIFYVAAQLLGAVAGAALLHELTPPDIRG
Uniprot No.

Target Background

Function
Aquaporin-2 (AQP2) forms a water-specific channel within the plasma membranes of renal collecting duct cells, enabling high water permeability. This allows water to move along osmotic gradients, facilitating crucial physiological processes.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Orycteropus afer Aquaporin-2 (AQP2)?

Recombinant Orycteropus afer AQP2 is a laboratory-expressed water channel protein that replicates the native AQP2 found in aardvark renal collecting ducts. Similar to other mammalian AQP2 proteins, aardvark AQP2 likely forms a homotetrameric structure that facilitates water transport across cell membranes. The recombinant form typically includes modifications such as histidine-tagging to facilitate purification and detection, comparable to methods used for human AQP2 expression . This protein represents a valuable research tool for comparative physiology studies examining water conservation mechanisms in desert-adapted mammals.

How does AQP2 function in the renal collecting duct system?

In mammals including Orycteropus afer, AQP2 functions as the primary vasopressin-regulated water channel in the renal collecting duct. AQP2 is localized to the apical plasma membrane and intracellular vesicles of collecting duct principal cells . Water reabsorption across this epithelium occurs through two distinct regulatory mechanisms: 1) short-term regulation involving trafficking of AQP2-containing vesicles to and from the apical plasma membrane in response to vasopressin, and 2) long-term regulation involving changes in total AQP2 protein abundance . These mechanisms enable precise control of water balance in response to physiological needs.

What is the physiological importance of AQP2 in water balance?

AQP2 serves as the rate-limiting factor for water reabsorption in the collecting duct, making it essential for urine concentration and maintaining whole-body water homeostasis . Dysregulation of AQP2 is implicated in numerous water balance disorders, including those associated with polyuria (excessive urine production) such as nephrogenic diabetes insipidus, and those characterized by inappropriate water retention like syndrome of inappropriate antidiuresis (SIADH) . The expression and regulation of AQP2 appears to be conserved across mammalian species, highlighting its evolutionary importance in water conservation .

What is known about the structure of mammalian AQP2?

Mammalian AQP2, including that from Orycteropus afer, likely possesses the characteristic structural features of the aquaporin family. Human AQP2 forms a homotetramer with each monomer containing six transmembrane domains . Studies on human recombinant AQP2 have demonstrated that the protein retains its homotetrameric structure when expressed in heterologous systems and exhibits a single channel water permeability of approximately 0.93±0.03×10^(-13) cm³/s . The C-terminal region contains multiple phosphorylation sites critical for vasopressin-mediated regulation, particularly trafficking to the apical membrane .

What expression systems are optimal for producing recombinant Orycteropus afer AQP2?

Based on successful strategies for human AQP2 expression, several systems could be suitable for producing recombinant aardvark AQP2:

Expression SystemAdvantagesLimitationsOptimal Conditions
Baculovirus/Insect Cell- Preserves tetrameric structure
- High expression levels (0.5 mg/L)
- Proper protein folding
- Higher cost
- More complex setup
27-28°C, pH 6.2-6.9, 3-4 days post-infection
Mammalian Cell Lines- Proper post-translational modifications
- Native-like membrane environment
- Lower yields
- Higher cost
37°C, 5% CO₂, serum-free media for final 24-48h
Yeast (Pichia pastoris)- High biomass
- Cost-effective
- Scalable
- May require codon optimization
- Hyperglycosylation risk
30°C, methanol induction, controlled pH 5-6
E. coli- Rapid growth
- Low cost
- Simple genetics
- Refolding often required
- Lack of post-translational modifications
18-25°C induction, specialized strains (C41/C43)

The baculovirus/insect cell system has been demonstrated to produce functional human AQP2 that retains its tetrameric structure and water transport ability, making it a particularly promising option for aardvark AQP2 .

What purification strategies yield the highest purity of recombinant AQP2?

A multi-step purification approach is typically required for membrane proteins like AQP2:

  • Membrane preparation and solubilization: Cells expressing AQP2 should be lysed and membranes isolated by differential centrifugation. Solubilization with appropriate detergents (such as n-dodecyl-β-D-maltoside or n-octyl-β-D-glucoside) is critical for maintaining protein structure .

  • Affinity chromatography: For His-tagged AQP2, immobilized metal affinity chromatography (IMAC) provides effective initial purification. Careful optimization of imidazole concentrations in wash and elution buffers minimizes non-specific binding while maximizing recovery.

  • Size exclusion chromatography: This step separates tetrameric AQP2 from aggregates and monomers, ensuring functional homogeneity.

  • Quality assessment: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) can confirm tetrameric assembly, while SDS-PAGE and Western blotting verify purity and identity.

Using this approach, researchers have achieved greater than 95% purity for human recombinant AQP2, suitable for functional and structural studies .

How can the functionality of recombinant Orycteropus afer AQP2 be assessed?

Functional assessment of recombinant aardvark AQP2 would employ multiple complementary techniques:

Functional AssayMeasurementKey ParametersExpected Results
Stopped-flow light scatteringWater permeability of proteoliposomesRate of vesicle shrinkage upon osmotic gradientSingle channel permeability ~0.9-1.0×10^(-13) cm³/s
Xenopus oocyte expressionOsmotic water permeabilityCell swelling rate in hypotonic solution5-10 fold increase vs. control oocytes
Phosphorylation analysisRegulatory modificationDetection of phosphorylated residuesPhosphorylation at Ser256-equivalent residue
ImmunofluorescenceSubcellular traffickingMembrane localization after vasopressinIncreased apical membrane localization
Blue native PAGEOligomeric stateMigration patternTetrameric assembly ~120-130 kDa

These assays collectively evaluate the key functional attributes of AQP2: water permeability, proper structural assembly, and responsiveness to physiological regulation.

How does vasopressin regulate AQP2 at the transcriptional level?

Vasopressin mediates long-term regulation of AQP2 through transcriptional mechanisms that increase AQP2 mRNA and subsequent protein levels . This process involves:

  • cAMP signaling pathway: Vasopressin binding to V2 receptors activates adenylyl cyclase 6, increasing intracellular cAMP levels in collecting duct principal cells .

  • Transcription factor activation: Several transcription factors have been identified in the 5' flanking region of the AQP2 gene. While vasopressin-mediated regulation of AQP2 gene transcription is not fully understood, proteomics studies have identified candidate transcription factors .

  • mRNA stability: Vasopressin increases both transcription rate and mRNA stability, leading to higher steady-state levels of AQP2 mRNA .

  • Protein translation: Increased AQP2 abundance in response to vasopressin is primarily due to enhanced translation following increases in AQP2 mRNA .

  • Protein half-life extension: Vasopressin has been shown to increase the half-life of AQP2 protein from approximately 10 to 14 hours in cultured collecting duct cells .

What techniques are essential for studying AQP2 trafficking in response to vasopressin?

Investigating the dynamic trafficking of AQP2 requires sophisticated methodological approaches:

  • Live-cell imaging with fluorescent protein fusions: Real-time visualization of AQP2-GFP trafficking in response to vasopressin stimulation provides temporal and spatial resolution of vesicle movement.

  • Surface biotinylation assays: Quantitative assessment of plasma membrane AQP2 levels before and after vasopressin treatment.

  • TIRF microscopy: Total Internal Reflection Fluorescence microscopy allows selective visualization of vesicle fusion events at the plasma membrane.

  • Phospho-specific antibodies: Detection of specific phosphorylation sites (e.g., Ser256, Ser261, Ser264, Ser269) that regulate AQP2 trafficking and membrane retention .

  • Electron microscopy: Immunogold labeling can precisely localize AQP2 at the ultrastructural level, distinguishing between different membrane compartments.

  • Calcium imaging: High-resolution imaging techniques have demonstrated that vasopressin induces aperiodic calcium spikes in individual collecting duct cells, which are associated with AQP2 trafficking .

These methods collectively enable researchers to dissect the complex molecular machinery involved in AQP2 vesicle trafficking, which occurs within minutes of vasopressin stimulation.

How can site-directed mutagenesis elucidate functional domains of Orycteropus afer AQP2?

Site-directed mutagenesis provides powerful insights into structure-function relationships in AQP2:

  • Water pore residues: Mutations in the conserved NPA (asparagine-proline-alanine) motifs that form the water-selective pore can confirm their role in determining water permeability and selectivity.

  • Phosphorylation sites: Creating phospho-mimetic (e.g., Ser→Asp) or phospho-deficient (e.g., Ser→Ala) mutations at putative regulatory sites can identify residues critical for vasopressin-mediated trafficking.

  • Tetramerization domains: Mutations at monomer interfaces can disrupt oligomerization and reveal the importance of tetrameric assembly for function and trafficking.

  • Ubiquitination sites: AQP2 can be oligo-ubiquitinated at lysine-270, which targets the protein for lysosomal degradation . Mutating this residue can alter protein half-life and membrane abundance.

  • Species-specific adaptations: Comparing the effects of equivalent mutations in aardvark versus human AQP2 could reveal evolutionary adaptations related to water conservation in arid environments.

Results from these studies would provide a comprehensive functional map of aardvark AQP2 domains involved in water transport, regulation, and protein-protein interactions.

What are the signaling pathways coupling vasopressin receptor activation to AQP2 regulation?

The vasopressin signaling cascade involves multiple interconnected pathways:

Signaling ComponentFunctionEffect on AQP2Research Methods
cAMP/PKA pathwayPrimary vasopressin signalPhosphorylation of AQP2 at Ser256PKA inhibitors, phospho-antibodies
Ca²⁺/calmodulinSecondary messengerEnhanced trafficking, activation of myosin light chain kinaseCa²⁺ chelators, calmodulin antagonists
PI3K/Akt pathwayVasopressin-activated kinaseUnknown effects on long-term regulationPI3K inhibitors, Akt phosphorylation
ERK1/2 MAPK pathwayInhibited by vasopressinModulation of AQP2 phosphorylationERK inhibitors, phospho-proteomics
Rho/ROCK pathwayCytoskeletal regulationModulates actin dynamics affecting traffickingROCK inhibitors, actin visualization

Phosphoproteomics studies have demonstrated that basophilic kinases (especially AGC and calmodulin-regulated kinases) show increased activity in response to vasopressin, while proline-directed kinases (MAP kinases and cyclin-dependent kinases) exhibit decreased activity . These complex signaling networks ensure precise regulation of both short-term trafficking and long-term expression of AQP2.

How can recombinant Orycteropus afer AQP2 serve as a model for studying water balance disorders?

Recombinant aardvark AQP2 offers unique potential as a comparative model for studying water balance disorders:

  • Evolutionary adaptations: As desert-adapted mammals, aardvarks likely possess specialized water conservation mechanisms. Comparing aardvark and human AQP2 regulation may reveal novel therapeutic targets for water balance disorders.

  • Disease modeling: Introducing mutations associated with human nephrogenic diabetes insipidus into aardvark AQP2 could identify species-specific differences in protein folding, trafficking, or function that might inform therapeutic approaches.

  • Drug discovery platform: Cell lines expressing aardvark AQP2 could serve as screening systems for compounds that modulate water channel activity or membrane abundance, with potential applications in treating conditions like SIADH or nephrogenic diabetes insipidus .

  • Structural insights: Structural studies of aardvark AQP2 might reveal novel conformational states or regulatory binding sites not readily observed in human AQP2, providing new targets for drug development.

  • Resistance mechanisms: Investigating whether aardvark AQP2 exhibits resistance to dysregulation by factors like lithium (which causes nephrogenic diabetes insipidus in humans) could uncover natural protective mechanisms.

These comparative studies have the potential to illuminate evolutionary solutions to water balance challenges that might be adapted for therapeutic interventions in human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.