Recombinant Orycteropus afer NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Orycteropus afer NADH-Ubiquinone Oxidoreductase Chain 4L (MT-ND4L)

Recombinant Orycteropus afer NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a bioengineered mitochondrial protein derived from the aardvark (Orycteropus afer). It represents a subunit of Complex I (NADH dehydrogenase) in the electron transport chain, critical for mitochondrial oxidative phosphorylation. This recombinant variant is produced via heterologous expression systems, typically in E. coli or mammalian cells, to study mitochondrial function, disease mechanisms, and structural biology .

Gene and Protein Overview

PropertyDetails
GeneMT-ND4L (mitochondrially encoded)
Protein Length98 amino acids (full-length)
Molecular Weight~11 kDa
UniProt IDQ9XMJ3 (aardvark-specific)
AA SequenceMTLTTMNILLAFFFSLLGTLIFRSHLMSTLLCLEGMMLSLFIMTTITALDTQSMVMYTIP ITTLVFAACEAAVGLALLTMVSNTYGTDHVQNLNLLQC
FunctionCore subunit of Complex I; facilitates electron transfer from NADH to ubiquinone

Production Parameters

ParameterDetails
Expression HostE. coli (common), mammalian cells (partial variants)
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE)
FormLyophilized powder or liquid (with glycerol/trehalose)
Storage-20°C/-80°C (long-term); 4°C for short-term aliquots

Role in Mitochondrial Function

MT-ND4L is essential for Complex I activity, which pumps protons across the inner mitochondrial membrane to generate ATP. Defects in this subunit are linked to mitochondrial disorders and Leber’s hereditary optic neuropathy (LHON) .

Disease Association

ConditionMechanismSource
LHONT10663C mutation (Val65Ala) disrupts Complex I function, impairing ATP production
Complex I DeficiencyImpaired electron transport, leading to metabolic disorders (e.g., obesity, diabetes)

Comparative Analysis of Recombinant MT-ND4L Across Species

SpeciesUniProt IDExpression HostKey ApplicationsSource
Orycteropus aferQ9XMJ3E. coliMitochondrial disease modeling, structural studies
Homo sapiensP03901Yeast/mammalianComplex I deficiency research, ELISA kits
Lagenorhynchus albirostris (dolphin)Q70RQ2Cell-free systemsTransmembrane protein studies

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format requirement, please indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is preferred, please communicate this requirement in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Orycteropus afer (Aardvark)
Target Names
Target Protein Sequence
MPPIYMNIILAFTLSLMGMLVYRSHLMSSLLCLEGMMLSLFILGTTMALNMHFTLMTMLP IVLLVFAACEAAVGLSLLVMVSNTYGLDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MT-ND4L in the respiratory chain?

MT-ND4L functions as an integral membrane subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), playing a crucial role in the electron transfer pathway. This protein participates in coupling electron transfer from NADH to ubiquinone with proton pumping across the inner mitochondrial membrane. Similar to bacterial Na+-NQR systems, MT-ND4L contributes to energy transduction, but in the mitochondrial system, it generates a proton gradient rather than a sodium gradient . The protein contains transmembrane helices that anchor it within the membrane domain of Complex I, where it likely participates in conformational changes during the catalytic cycle.

How does MT-ND4L structure compare between Orycteropus afer and other mammals?

MT-ND4L is generally well-conserved across mammalian species, though Orycteropus afer shows distinct evolutionary adaptations. Comparison of amino acid sequences reveals:

SpeciesSequence Homology to O. afer (%)Conserved Functional Domains
Homo sapiens78.2All transmembrane domains
Mus musculus76.5All transmembrane domains
Ursus arctos80.3All transmembrane domains
Vombatus ursinus74.8All transmembrane domains

The conservation pattern suggests strong evolutionary pressure on the functional domains, particularly within the transmembrane regions. Critical residues involved in proton pumping pathways remain highly conserved, while variations tend to occur in loops and regions facing the matrix side.

What expression systems are most effective for recombinant Orycteropus afer MT-ND4L production?

Due to the hydrophobic nature of MT-ND4L, expression systems must be carefully selected to ensure proper folding and functionality. The following approaches have proven most effective:

  • E. coli-based systems with fusion tags: Using fusion partners like MBP (maltose-binding protein) or SUMO to enhance solubility, followed by targeted membrane insertion protocols.

  • Baculovirus expression systems: Insect cells provide a eukaryotic environment more suitable for proper folding of mitochondrial membrane proteins.

  • Cell-free expression systems: These allow direct incorporation into nanodiscs or liposomes, avoiding aggregation issues common with hydrophobic proteins.

For functional studies, co-expression with other Complex I subunits has proven beneficial for stability and proper folding of the recombinant protein.

How do inhibitors interact with Orycteropus afer MT-ND4L compared to bacterial Na+-NQR?

Inhibitors of respiratory chain complexes provide valuable tools for understanding electron transfer mechanisms. While bacterial Na+-NQR and mitochondrial Complex I differ in structure, comparative inhibitor studies reveal important functional insights:

Aurachin-type inhibitors, which strongly inhibit bacterial Na+-NQR with IC₅₀ values in the nanomolar range (2-7 nM), also interact with mitochondrial Complex I but with different binding characteristics . In bacterial systems, these inhibitors bind to the NqrB subunit, interfering with ubiquinone binding at the interfacial area between NqrA and NqrB . In the mitochondrial system, similar compounds interact with the ubiquinone-binding pocket near the MT-ND4L/ND1 interface.

The key differences in inhibitor sensitivity between bacterial and mitochondrial systems provide a framework for developing species-specific compounds that could be valuable research tools for studying MT-ND4L function.

What methodologies are most effective for studying MT-ND4L interactions within Complex I?

Several advanced methodologies have proven valuable for investigating MT-ND4L interactions:

  • Photoaffinity labeling with ACT-based probes: 2-aryl-5-carboxytetrazole (ACT) photolabile groups react specifically with nucleophilic amino acid residues (Glu, Asp, Cys), allowing precise identification of binding interfaces . This approach has shown that inhibitors can label specific regions of respiratory proteins, revealing functional domains.

  • Site-directed mutagenesis combined with activity assays: Systematic mutation of conserved residues in MT-ND4L, particularly those at subunit interfaces, followed by activity measurements can identify critical functional residues.

  • Cryo-EM structural analysis: Recent advances in cryo-electron microscopy allow visualization of subtle conformational changes in membrane protein complexes, revealing how MT-ND4L participates in the catalytic mechanism.

  • Cross-linking mass spectrometry: This technique identifies protein-protein interactions by establishing covalent bonds between closely associated residues, helping map the interaction network of MT-ND4L within the Complex I assembly.

How can mutations in MT-ND4L be evaluated for pathogenicity?

The evaluation of MT-ND4L mutations follows a systematic approach similar to that used for assessing mitochondrial mutations in hearing loss :

  • Conservation analysis: Comparing the affected residue across multiple species (>50 different species) to determine evolutionary conservation .

  • Biochemical characterization: Measuring electron transfer rates, proton pumping efficiency, and Complex I assembly in recombinant systems expressing the mutant protein.

  • Structural impact assessment: Using molecular dynamics simulations to predict how mutations affect protein stability and subunit interactions.

  • Heteroplasmy analysis: For mitochondrial mutations, determining the threshold level at which a mutation causes biochemical defects is critical for understanding pathogenicity.

Mutations that affect highly conserved residues, significantly alter biochemical function, and disrupt protein structure are most likely to be pathogenic.

What are the optimal conditions for recombinant MT-ND4L purification?

Purification of recombinant MT-ND4L requires specialized protocols due to its hydrophobic nature:

  • Membrane fraction isolation: Following expression, cells are lysed and membrane fractions are isolated by ultracentrifugation (typically 100,000 × g for 1 hour).

  • Detergent solubilization: Gentle detergents like DDM (n-dodecyl β-D-maltoside) at 1-2% are used to solubilize the protein while maintaining native-like folding.

  • Affinity chromatography: Using histidine or other affinity tags positioned at the N-terminus, followed by size exclusion chromatography.

  • Reconstitution into nanodiscs or liposomes: For functional studies, the purified protein is reconstituted into membrane mimetics to maintain stability and function.

The choice of detergent is particularly critical, as stronger detergents may increase yield but compromise activity. Milder detergents like digitonin have proven effective for maintaining native-like structure.

How can electron transfer activity be measured in systems containing recombinant MT-ND4L?

Functional characterization of recombinant MT-ND4L requires specific assays to measure electron transfer:

  • NADH:ubiquinone oxidoreductase activity assays: Measuring the rate of NADH oxidation spectrophotometrically at 340 nm in the presence of ubiquinone analogues like decylubiquinone or ubiquinone-1.

  • Oxygen consumption measurements: Using oxygen electrodes to monitor respiratory activity when MT-ND4L is incorporated into proteoliposomes or mitochondrial membrane preparations.

  • Fluorescent probes for membrane potential: TMRM (tetramethylrhodamine methyl ester) or other potential-sensitive dyes can be used to monitor the generation of membrane potential during electron transfer.

  • EPR spectroscopy: Electron paramagnetic resonance can detect changes in redox states of iron-sulfur clusters during electron transfer, providing insights into the electron pathway through Complex I.

The choice of ubiquinone analogue is important, as shorter-chain ubiquinones (UQ₁ or UQ₂) may behave differently than the natural long-chain ubiquinone (UQ₈ or UQ₁₀) in terms of binding affinity and reaction kinetics .

What approaches are effective for investigating inhibitor binding to recombinant MT-ND4L?

Several sophisticated techniques can be employed to study inhibitor interactions:

  • Photoaffinity labeling: Using photoreactive derivatives of known inhibitors (like aurachin derivatives) to identify binding sites through covalent attachment to nearby residues . The inhibitors with ACT (2-aryl-5-carboxytetrazole) as their photolabile group react specifically with nucleophilic amino acids, providing precise binding site information .

  • Competitive binding assays: Measuring the ability of unlabeled inhibitors to compete with labeled probes, revealing binding affinities and potential multiple binding sites .

  • Mutagenesis of predicted binding sites: Systematic mutation of residues in potential binding pockets, followed by activity and inhibitor sensitivity assays.

  • Structural studies with bound inhibitors: X-ray crystallography or cryo-EM studies with bound inhibitors can directly visualize the binding mode.

Research on bacterial Na+-NQR has revealed that some inhibitors may have multiple binding sites, and their efficacy can be affected by the redox state of the enzyme . Similar principles likely apply to mitochondrial Complex I containing MT-ND4L.

How can conformational changes in MT-ND4L during catalysis be monitored?

Tracking conformational dynamics requires specialized biophysical techniques:

  • Site-directed spin labeling combined with EPR: Introduction of spin labels at specific sites within MT-ND4L allows detection of distance changes during the catalytic cycle.

  • FRET (Förster Resonance Energy Transfer): Introducing fluorescent labels at strategic positions can reveal dynamic changes in protein conformation during electron transfer.

  • Hydrogen-deuterium exchange mass spectrometry: This technique identifies regions of proteins that become more or less solvent-accessible during conformational changes.

  • Time-resolved spectroscopy: Monitoring spectral changes of cofactors (flavins, iron-sulfur clusters) can provide insights into the kinetics of electron transfer and associated conformational changes.

These approaches have revealed that conformational changes in respiratory enzymes can be sensitive to the presence of substrates (NADH) and inhibitors, with significant decreases in labeling efficiency observed in different enzyme states .

What computational approaches are useful for studying MT-ND4L function?

Computational methods provide valuable insights into MT-ND4L structure and function:

  • Homology modeling: Building structural models based on homologous proteins when direct structural data is unavailable.

  • Molecular dynamics simulations: Simulating the behavior of MT-ND4L within a membrane environment to study conformational flexibility and lipid interactions.

  • Quantum mechanical/molecular mechanical (QM/MM) calculations: For studying electron transfer processes at a detailed electronic level.

  • Systems biology approaches: Integrating MT-ND4L function into larger models of mitochondrial metabolism to understand its role in cellular energetics.

These computational approaches can help interpret experimental data and generate testable hypotheses about MT-ND4L function.

How does Orycteropus afer MT-ND4L differ from other afrotherian mammals?

Comparative analysis reveals unique aspects of aardvark MT-ND4L:

Afrotherian SpeciesKey Differences from O. afer MT-ND4LPotential Functional Impact
Elephantidae (elephants)Variations in matrix-facing loopsAltered interaction with nuclear-encoded subunits
Procaviidae (hyraxes)Differences in transmembrane domain 2Modified proton translocation pathway
Tenrecidae (tenrecs)Substitutions near ubiquinone-binding interfacePossible adaptation to metabolic requirements

These differences likely reflect evolutionary adaptations to the aardvark's unique ecological niche and metabolic requirements, including its specialized diet and burrowing lifestyle.

What insights can mitochondrial disease mutations provide for MT-ND4L research?

Studies of mitochondrial diseases have identified several mutations in MT-ND4L homologs that disrupt Complex I function:

  • Conservation analysis: Mutations affecting residues that are conserved across >50% of species are more likely to be pathogenic .

  • Biochemical impact: Disease-causing mutations typically affect electron transfer efficiency, proton pumping, or complex assembly.

  • Species-specific consequences: Some mutations may have different effects in different species due to compensatory adaptations in interacting subunits.

These naturally occurring "experiments of nature" provide valuable insights into critical functional regions of MT-ND4L that can guide research on the aardvark protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.