Recombinant Oryza nivara Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Oryza nivara (Indian wild rice)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPG KKYSEIVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVR KILRKEKGGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its functional role in Oryza nivara?

Apocytochrome f is a protein encoded by the chloroplast petA gene in Oryza nivara (Indian wild rice). It plays a critical role in photosynthetic electron transport as part of the cytochrome b6f complex. The mature protein spans amino acids 36-320 and functions as an essential component in the electron transfer between photosystem II and photosystem I . The protein contains a characteristic heme-binding domain and transmembrane region, which are crucial for its electron transfer function in the thylakoid membrane of chloroplasts .

What are the optimal storage conditions for recombinant Oryza nivara Apocytochrome f protein?

For optimal storage of recombinant Oryza nivara Apocytochrome f:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 50%

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles

  • For short-term storage (up to one week), working aliquots can be kept at 4°C

  • For long-term storage, keep at -20°C or preferably -80°C

Repeated freezing and thawing should be avoided as it can lead to protein degradation and loss of activity .

What is the recommended reconstitution protocol for lyophilized Apocytochrome f protein?

The recommended reconstitution protocol is:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended for optimal stability)

  • Mix gently to ensure complete solubilization

  • Aliquot into smaller volumes for storage

This protocol helps maintain protein stability and activity while minimizing degradation during storage cycles.

How can researchers verify the purity and integrity of recombinant Oryza nivara Apocytochrome f?

Researchers can verify the purity and integrity of recombinant Apocytochrome f using multiple complementary techniques:

  • SDS-PAGE analysis: The protein should show >90% purity with a single dominant band at the expected molecular weight

  • Western blotting: Using antibodies specific to Apocytochrome f or the His-tag for tagged versions

  • Mass spectrometry: To confirm the exact molecular weight and potential post-translational modifications

  • Circular dichroism (CD) spectroscopy: To verify proper protein folding and secondary structure

  • Functional assays: To confirm electron transfer activity, which may include reduction/oxidation assays with appropriate electron donors/acceptors

These methods collectively provide comprehensive verification of protein quality before experimental use.

What does genetic analysis reveal about the relationship between Oryza nivara and Oryza rufipogon petA genes?

Genetic analysis shows a complex relationship between the petA genes of Oryza nivara and Oryza rufipogon:

  • Despite being classified as separate species, O. nivara and O. rufipogon show extensive allele sharing, suggesting recent divergence or ongoing gene flow

  • Principal coordinate analysis and Bayesian clustering demonstrate partial but incomplete separation between these species

  • Local-level species separation is more pronounced than global patterns, indicating that geographic factors may influence genetic differentiation

  • The petA gene, being chloroplast-encoded, follows maternal inheritance patterns and can provide insights into hybridization events between these species

While there is significant genetic overlap between these species at the genomic level, local adaptation has led to maintenance of species boundaries in sympatric populations .

How do phenotypic characteristics correlate with genetic differences in the Oryza rufipogon Species Complex (ORSC)?

The correlation between phenotypic characteristics and genetic differences in the ORSC shows complex patterns:

TraitQST valueZ testSignificance
Anther length (ANL)0.9898-28.711***
Awn length (AWL)0.98073.794***
Culm diameter (CD)0.9504-4.544***
Culm length (CL)0.9879-22.798***
Flag leaf attitude (FLA)0.9659-4.223***
Flag leaf length (FLL)0.88480.546NS
Flag leaf width (FLW)0.9666-1.369NS
Panicle exsertion (PE)0.9808-13.667***
Panicle neck spikelet length (PNSPL)0.9534-7.120***

The significantly larger QST values compared to FST (0.129) for most traits suggests that natural selection, rather than genetic drift, is the primary driver of phenotypic differentiation between O. rufipogon and O. nivara . This indicates adaptive divergence in response to different ecological conditions, despite the genetic similarity observed in some markers.

How can recombinant Apocytochrome f be used to study photosynthetic electron transport chain assembly?

Recombinant Apocytochrome f can be used as a powerful tool for studying photosynthetic electron transport chain assembly through several approaches:

  • In vitro reconstitution experiments: Purified recombinant Apocytochrome f can be combined with other components of the cytochrome b6f complex to study assembly mechanisms and requirements

  • Protein-protein interaction studies: Using techniques such as pull-down assays, surface plasmon resonance (SPR), or isothermal titration calorimetry (ITC) to identify and characterize interactions with other components of the photosynthetic machinery

  • Structural studies: Recombinant protein can be used for crystallization trials or cryo-EM analysis to determine high-resolution structures

  • Site-directed mutagenesis: Key residues can be modified to assess their role in complex assembly and function

  • Heterologous expression systems: The recombinant protein can be expressed in model organisms to study assembly factors and chaperones

These approaches contribute to understanding how chloroplast-encoded proteins like Apocytochrome f are incorporated into functional photosynthetic complexes.

What experimental approaches can be used to study the impact of environmental stressors on Apocytochrome f function?

To study the impact of environmental stressors on Apocytochrome f function, researchers can employ multiple experimental approaches:

  • Comparative expression analysis: Quantify petA transcript and protein levels under various stress conditions (drought, temperature, salinity) in wild-type plants

  • Recombinant protein stability assays: Test how temperature, pH, salt concentration, and reactive oxygen species affect the stability and function of purified recombinant Apocytochrome f

  • Electron transport measurements: Assess electron transfer rates using artificial electron donors/acceptors under various stress conditions

  • Structural analysis: Use circular dichroism or fluorescence spectroscopy to monitor stress-induced conformational changes

  • In vivo imaging techniques: Utilize fluorescently tagged versions to track protein localization and turnover under stress

  • Comparative species analysis: Compare stress responses of Apocytochrome f from stress-tolerant vs. stress-sensitive Oryza species to identify adaptive variations

This multi-faceted approach provides insights into how environmental factors affect photosynthetic efficiency at the molecular level.

How can structural analysis of Apocytochrome f contribute to understanding species-specific adaptations in photosynthesis?

Structural analysis of Apocytochrome f can reveal species-specific adaptations in photosynthesis through:

  • Comparative structural biology: High-resolution structures of Apocytochrome f from different Oryza species can be compared to identify subtle variations in functional domains

  • Molecular dynamics simulations: Computational analysis of protein flexibility and conformational states under different conditions can reveal adaptations to specific environmental niches

  • Structure-function relationship studies: Correlating structural variations with differences in electron transfer efficiency, redox potential, or binding kinetics

  • Evolutionary structural biology: Mapping sequence variations from different species onto structural models to identify positively selected residues that may confer adaptive advantages

  • Chimeric protein studies: Creating hybrid proteins with domains from different species to identify regions responsible for species-specific photosynthetic characteristics

These approaches can elucidate how subtle variations in the structure of Apocytochrome f contribute to adaptation to different ecological niches across the Oryza genus.

What are the implications of petA gene conservation for understanding chloroplast genome evolution in the Oryza genus?

The high conservation of the petA gene across Oryza species has several implications for understanding chloroplast genome evolution:

  • The identical amino acid sequences of Apocytochrome f between O. nivara and O. sativa japonica suggest strong purifying selection on this photosynthetic protein despite species divergence

  • Conservation of chloroplast genes like petA can be contrasted with the greater variation in nuclear genes to understand different evolutionary pressures on the two genomes

  • The petA gene can serve as a reference point for calibrating molecular clocks in chloroplast genome evolution

  • Geographic patterns of petA variation can help reconstruct historical migration and domestication pathways of rice species

  • The contrast between conserved coding regions and potentially more variable non-coding regions in the chloroplast genome provides insights into functional constraints on photosynthetic machinery

This understanding contributes to broader knowledge of organellar genome evolution and the interplay between nuclear and chloroplast genomes during speciation.

How might studies of Apocytochrome f contribute to engineering improved photosynthetic efficiency in crops?

Studies of Apocytochrome f could contribute to improved photosynthetic efficiency in crops through several potential applications:

  • Targeted mutagenesis: Identification of specific amino acid residues that could be modified to enhance electron transport rates or stability under stress conditions

  • Optimized protein expression: Engineering regulatory elements to ensure optimal stoichiometry of photosynthetic components

  • Environmental adaptation: Understanding how natural variation in Apocytochrome f contributes to adaptation to different light environments or temperature conditions

  • Stress tolerance: Identifying variants with improved function under drought, high temperature, or high light conditions

  • Synthetic biology approaches: Redesigning portions of the protein to incorporate beneficial features from diverse species while maintaining core functionality

These approaches align with broader efforts in genomics of chloroplasts and mitochondria to enhance energy efficiency in crop plants through targeted modification of the photosynthetic apparatus.

What methodological challenges remain in studying chloroplast-encoded proteins like Apocytochrome f?

Despite advances in recombinant protein technology, several methodological challenges remain in studying chloroplast-encoded proteins like Apocytochrome f:

  • Post-translational modifications: Ensuring that recombinant proteins produced in bacterial systems accurately reflect the modifications present in plant chloroplasts

  • Membrane protein solubility: Developing improved methods for solubilization and purification that maintain native conformations

  • Functional reconstitution: Creating experimental systems that accurately reproduce the lipid environment and protein interactions of the thylakoid membrane

  • Chloroplast transformation: Improving techniques for direct modification of the chloroplast genome to study protein variants in vivo

  • Integration with other omics approaches: Developing methods to correlate protein structure/function with transcriptomic, metabolomic, and phenomic data

  • Real-time imaging: Creating non-disruptive methods to visualize protein dynamics in living plant cells

Addressing these challenges will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and advanced imaging technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.