Recombinant Oryza nivara ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
atpI
Target Protein Sequence
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSAAYFYAGLSNKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
ATP synthase subunit a is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does atpI differ between Oryza nivara and cultivated rice species?

Specific differences include:

  • Minor nucleotide variations in the atpI coding region

  • Differences in the junction regions between LSC and IR regions near the atpI gene

  • Variations in the atpI-atpH intergenic region that shows greater divergence than the coding regions themselves

These differences may contribute to adaptations in wild rice (O. nivara) that allow for optimal ATP synthase function under diverse environmental conditions compared to cultivated rice.

What are the optimal conditions for expressing recombinant Oryza nivara atpI in E. coli?

For optimal expression of recombinant Oryza nivara atpI in E. coli, the following methodological approach is recommended:

  • Expression system: E. coli BL21(DE3) strain has shown highest efficiency for chloroplastic proteins.

  • Vector selection: pET28a vector incorporating an N-terminal His-tag for purification.

  • Induction parameters:

    • IPTG concentration: 0.5-1.0 mM

    • Induction temperature: 20-25°C (reduced temperature improves protein folding)

    • Induction time: 16-18 hours

  • Growth medium: Enriched LB or TB medium supplemented with appropriate antibiotics.

  • Post-induction harvesting: Centrifugation at 6,000×g for 15 minutes at 4°C

It's critical to optimize codon usage for plant genes expressed in E. coli systems. Utilizing strains with extra copies of rare tRNAs (such as Rosetta or CodonPlus strains) can significantly improve expression yields for chloroplastic proteins from rice.

What purification strategy yields the highest purity and activity for recombinant atpI protein?

A multi-step purification strategy is essential for obtaining high-purity active recombinant atpI:

  • Initial purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Binding buffer: 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash buffer: Same with 20-40 mM imidazole

    • Elution buffer: Same with 250-300 mM imidazole

  • Secondary purification:

    • Size exclusion chromatography (SEC) using Superdex 200

    • Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Critical considerations:

    • Include 0.05-0.1% mild detergent (DDM or LDAO) in all buffers to maintain membrane protein solubility

    • Add 10% glycerol to stabilize the protein structure

    • Conduct all purification steps at 4°C

  • Quality assessment:

    • SDS-PAGE analysis (>90% purity)

    • Western blot confirmation using anti-His antibodies

For functional studies, reconstitution into liposomes may be necessary to assess proton translocation activity, using a composition mimicking the chloroplast thylakoid membrane.

How can I assess the functional activity of recombinant Oryza nivara atpI in vitro?

To assess the functional activity of recombinant Oryza nivara atpI, several complementary approaches can be employed:

  • Proton conductivity measurements:

    • Reconstitute purified atpI into liposomes containing pH-sensitive fluorescent dyes (e.g., ACMA or pyranine)

    • Monitor fluorescence changes upon establishment of a pH gradient

    • Compare conductivity rates between wild-type and mutant forms of the protein

  • ATP synthase complex assembly assays:

    • Co-expression with other ATP synthase subunits

    • Blue Native PAGE to verify complex formation

    • Immunoprecipitation using anti-atpI antibodies to identify interacting partners

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Differential scanning calorimetry (DSC) to determine thermal stability

    • Isothermal titration calorimetry (ITC) for binding studies with other subunits

Research by Ermakova et al. (2022) demonstrated that increased ATP synthase activity in rice correlates with enhanced proton conductivity of the thylakoid membrane, which can be measured using electrochromic shift (ECS) spectroscopy techniques .

What experimental approaches can distinguish between assembly and functional roles of atpI in ATP synthase?

Distinguishing between assembly and functional roles of atpI requires sophisticated experimental designs:

  • Assembly role investigation:

    • Generate truncated versions of atpI to identify domains critical for complex assembly

    • Perform co-immunoprecipitation with other ATP synthase subunits

    • Use Blue Native PAGE combined with western blotting to track complex formation

    • Employ pulse-chase experiments to monitor assembly kinetics

  • Functional role analysis:

    • Site-directed mutagenesis of conserved residues to create variants with potentially altered function

    • Proton conductivity assays with reconstituted proteoliposomes

    • Patch-clamp electrophysiology to measure ion conductance

  • Comparative analysis:

    • Create chimeric proteins exchanging domains between different Oryza species

    • Express atpI in ATP synthase-deficient bacterial strains (like those described in study )

    • Develop complementation assays in yeast mutants

Research on ATP synthase in alkaliphilic Bacillus pseudofirmus OF4 revealed that AtpI deletion reduced stability of the ATP synthase rotor and membrane association of the F1 domain, suggesting a chaperone-like role in assembly rather than being essential for c-ring formation .

What are the most effective transformation systems for studying atpI function in planta?

For studying atpI function in rice plants, several transformation systems have proven effective:

  • Agrobacterium-mediated transformation:

    • Most reliable for stable integration in rice

    • Procedure:

      • Use disarmed A. tumefaciens strain EHA105

      • Employ pCAMBIA vector series with modified CaMV 35S or rice ubiquitin promoters

      • Transform callus tissue derived from mature seeds

      • Select transformants on hygromycin-containing media

    • Transformation efficiency: 15-30% for japonica varieties, lower for indica

  • CRISPR/Cas9 genome editing:

    • For targeted mutagenesis of atpI

    • Design multiple gRNAs targeting conserved regions

    • Employ rice-optimized Cas9 with nuclear localization signals

    • Verify edits by deep sequencing

  • Virus-induced gene silencing (VIGS):

    • For transient knockdown studies

    • Use Brome mosaic virus (BMV) vectors

    • Requires careful timing for chloroplast-encoded genes

A key consideration is that atpI is chloroplast-encoded, requiring plastid transformation systems for direct modification. The most effective approach combines nuclear transformation with plastid targeting signals to introduce modified versions of atpI while silencing the native gene.

How can heterologous expression systems be optimized for atpI functional studies?

Optimizing heterologous expression systems for atpI functional studies requires addressing several challenges:

  • Bacterial expression systems:

    • E. coli C43(DE3) strain: Specifically designed for membrane protein expression

    • Use pET or pBAD vectors with tight expression control

    • Co-express with chaperones (GroEL/GroES) to improve folding

    • Culture conditions: Low temperature (16-20°C), low inducer concentration, rich media

  • Yeast expression systems:

    • Saccharomyces cerevisiae: Use fps1Δ strains (deletion of endogenous channel)

    • Employ GAL1 promoter for controlled expression

    • Growth medium: Supplement with optimal ion concentrations

  • Insect cell expression:

    • Baculovirus expression system using Sf9 or Hi5 cells

    • Add a C-terminal GFP tag for monitoring expression and localization

    • Optimize MOI (multiplicity of infection) and harvest timing

  • Cell-free expression systems:

    • Wheat germ extract supplemented with lipid nanodiscs

    • Allows direct incorporation into membrane mimetics during synthesis

Research on YidC-depleted E. coli has shown that complementation assays can effectively test functionality of heterologously expressed membrane proteins involved in ATP synthase assembly .

Which residues in Oryza nivara atpI are critical for proton translocation, and how can they be identified?

Identifying critical residues for proton translocation in Oryza nivara atpI requires systematic structure-function analysis:

  • Sequence-based predictions:

    • Comparative analysis of atpI sequences across different species reveals highly conserved residues likely essential for function

    • Hydrophobicity analysis identifies transmembrane segments involved in forming the proton channel

    • Key predicted functional residues include:

      • Acidic residues (Asp, Glu) involved in proton binding

      • Polar residues (Ser, Thr) forming hydrogen-bond networks

      • Glycine residues providing flexibility in transmembrane helices

  • Experimental validation approaches:

    • Alanine-scanning mutagenesis of conserved residues

    • Introduction of charged residues at specific positions to disrupt proton path

    • Cysteine-scanning accessibility studies with thiol-reactive reagents

    • pH-dependent spectroscopic analyses to identify protonation changes

  • Structural analysis integration:

    • Homology modeling based on related ATP synthase structures

    • Molecular dynamics simulations to predict proton paths

    • Validation using cross-linking and mass spectrometry

Studies on ATP synthase inhibitors provide valuable insights into residues critical for function, as these compounds often target conserved sites essential for proton translocation or subunit interactions .

How does the structure of atpI contribute to ATP synthase adaptation in different Oryza species?

The structural adaptation of atpI across Oryza species reflects evolutionary responses to diverse environmental conditions:

  • Comparative genomic analysis:

    • Sequence alignment of atpI from different Oryza species shows:

      • High conservation in transmembrane domains

      • Greater variability in loop regions

      • Species-specific substitutions in key functional regions

  • Structure-based adaptation mechanisms:

    • Modifications in hydrophobic residues at protein-lipid interfaces optimize membrane association

    • Variations in charged residues may adjust proton affinity and translocation rates

    • Alterations in interaction surfaces with other subunits influence complex stability

  • Functional consequences of adaptation:

    • Species from high-temperature environments show stabilizing substitutions

    • Variations correlate with photosynthetic efficiency under different light conditions

    • Adaptations in intermembrane regions may reflect response to varying pH environments

The comparison between wild rice (O. nivara) and cultivated rice shows that atpI sequence variations may contribute to differences in photosynthetic efficiency and environmental adaptation, particularly in stress conditions like drought or high temperatures .

How can recombinant atpI be utilized to enhance photosynthetic efficiency in rice?

Research indicates several strategies for utilizing atpI to enhance photosynthetic efficiency in rice:

  • Overexpression approaches:

    • Transgenic expression of optimized atpI genes

    • Co-expression with other ATP synthase subunits (particularly AtpD)

    • Use of tissue-specific or inducible promoters to fine-tune expression levels

  • Performance improvements demonstrated:

    • Increased CO₂ assimilation rates at high irradiance

    • Enhanced electron transport rates (J) at high CO₂

    • Higher maximum carboxylation rates (Vcmax)

    • Reduced cyclic electron flow

    • Improved ATP/ADP ratio in chloroplasts

  • Implementation considerations:

    • Balance with other photosynthetic components to avoid bottlenecks

    • Monitor potential stress responses from altered energy balance

    • Assess performance across different growth conditions

Ermakova et al. (2022) demonstrated that overexpression of the AtpD subunit in rice increased both abundance and activity of chloroplast ATP synthase, leading to enhanced photosynthetic performance, providing a model for similar approaches with atpI .

What phenotypic changes result from altered atpI expression in transgenic rice plants?

Altered atpI expression in transgenic rice produces several distinct phenotypic changes:

  • Photosynthetic parameters:

    • Enhanced CO₂ assimilation rates under high light conditions

    • Improved light use efficiency

    • Altered non-photochemical quenching (NPQ) response

    • Changed ATP/NADPH ratio affecting carbon fixation

  • Growth characteristics:

    • Potential increases in biomass accumulation

    • Altered leaf development and anatomy

    • Modified chloroplast ultrastructure

    • Changes in thylakoid membrane organization

  • Stress responses:

    • Altered tolerance to high light stress

    • Changed responses to temperature fluctuations

    • Modified water use efficiency

    • Potential impacts on pathogen resistance pathways

  • Yield components:

    • Effects on grain filling

    • Potential changes in harvest index

    • Impacts on reproductive development timing

Research on ATP/ADP transporters indicates that alterations in ATP metabolism can trigger defense responses against pathogens like Rhizoctonia solani, suggesting that atpI modification might confer additional resistance to sheath blight disease .

How does atpI functionally interact with other ATP synthase subunits?

The functional interactions between atpI and other ATP synthase subunits form a complex network essential for proper complex assembly and activity:

  • Key interaction partners:

    • Direct interactions with c-ring subunits (AtpH)

    • Association with subunit b (AtpF) for stator assembly

    • Potential interactions with AtpD during complex formation

    • Coordination with AtpE for proton channel formation

  • Interaction mechanisms:

    • Transmembrane helix packing between adjacent subunits

    • Electrostatic interactions at subunit interfaces

    • Hydrogen bonding networks stabilizing the proton path

    • Hydrophobic interactions maintaining structural integrity

  • Functional consequences of interactions:

    • Proper alignment of proton translocation pathway

    • Maintenance of rotor-stator spatial relationships

    • Stabilization of the complete ATP synthase complex

    • Coordination of proton flow with rotational catalysis

Studies in alkaliphilic Bacillus pseudofirmus OF4 revealed that AtpI plays a chaperone-like role in promoting proper assembly of ATP synthase, particularly in stabilizing the rotor and ensuring proper membrane association of the F1 domain .

What are the evolutionary relationships between atpI and other ATP synthase components across different plant species?

Evolutionary analysis of atpI and other ATP synthase components across plant species reveals interesting patterns:

  • Phylogenetic relationships:

    • atpI shows high conservation across Oryza species but with specific adaptations

    • Chloroplast-encoded subunits (including atpI) evolve at different rates than nuclear-encoded components

    • Evolutionary rate analysis indicates stronger selective pressure on certain ATP synthase domains

  • Co-evolution patterns:

    • Coordinated evolution between interacting subunits

    • Complementary substitutions maintaining structural integrity

    • Species-specific adaptations in interacting interfaces

  • Evolutionary constraints:

    • Highly conserved residues in proton channel pathways

    • Greater variation permitted in peripheral regions

    • Functional constraints maintaining efficient energy coupling

  • Taxonomic implications:

    • ATP synthase genes used for phylogenetic analyses in Oryza

    • atpI sequence variations align with established species relationships

    • Specific atpI haplotypes associated with different rice subpopulations

Analysis of chloroplast genomes across wild rice species shows that atpI and other ATP synthase genes serve as useful markers for understanding evolutionary relationships within the Oryza genus, with sequence variations reflecting adaptation to different ecological niches .

What are the main technical challenges in expressing and purifying functional recombinant atpI?

Expressing and purifying functional recombinant atpI presents several technical challenges:

  • Expression challenges:

    • Membrane protein toxicity to host cells

    • Protein misfolding and aggregation

    • Low expression yields

    • Formation of inclusion bodies

  • Purification obstacles:

    • Maintaining membrane protein solubility

    • Selecting appropriate detergents for extraction

    • Preventing protein denaturation during purification

    • Achieving high purity without compromising function

  • Methodological solutions:

    • Use specialized E. coli strains (C41, C43) designed for membrane proteins

    • Employ mild detergents (DDM, LDAO) for extraction

    • Include stabilizing agents (glycerol, specific lipids)

    • Optimize buffer conditions (pH, salt concentration)

    • Consider native purification approaches to maintain subunit interactions

  • Quality control considerations:

    • Verification of proper folding (CD spectroscopy)

    • Assessment of oligomeric state (SEC-MALS)

    • Functional validation in reconstituted systems

    • Stability monitoring during storage

A comprehensive approach combines optimized expression conditions with careful detergent selection and multi-step purification, as demonstrated in protocols for isolating intact and active ATP synthase from cyanobacteria .

How can researchers address the challenges of studying chloroplast-encoded proteins like atpI?

Studying chloroplast-encoded proteins like atpI presents unique challenges requiring specialized approaches:

  • Genetic manipulation limitations:

    • Difficulty in direct chloroplast genome editing

    • Limited availability of selectable markers for plastid transformation

    • Homoplasmy achievement challenges

    • Nuclear-chloroplast gene expression coordination

  • Alternative approaches:

    • Transplastomic techniques using biolistic transformation

    • RNA interference targeting chloroplast transcripts

    • Protein import studies using isolated chloroplasts

    • Heterologous expression with chloroplast targeting sequences

    • CRISPR-based technologies adapted for organelle genomes

  • Analytical considerations:

    • Organelle isolation protocols preserving protein complexes

    • Blue Native PAGE for intact complex analysis

    • Pulse-chase labeling to track chloroplast protein synthesis

    • Mass spectrometry adaptations for membrane proteins

    • Cryogenic electron microscopy for structural studies

  • Systems biology integration:

    • Combined transcriptomic and proteomic approaches

    • Modeling of nuclear-chloroplast gene expression networks

    • Consideration of retrograde signaling effects

Studies on chloroplast ATP synthase have utilized approaches like overexpression of nuclear-encoded subunits (e.g., AtpD) to indirectly affect the function of the entire complex, providing insights into approaches that might be applicable to studying atpI function .

How can atpI be used as a molecular marker for evolutionary studies in Oryza species?

The atpI gene serves as a valuable molecular marker for evolutionary studies in Oryza species:

  • Phylogenetic applications:

    • Chloroplast-encoded nature ensures maternal inheritance

    • Conserved coding regions provide reliable alignment across species

    • Variable intergenic regions (atpI-atpH) show appropriate evolutionary rates

    • SNPs within atpI correlate with species divergence patterns

  • Methodological approach:

    • PCR amplification of full-length atpI gene

    • Targeted sequencing of variable regions

    • Haplotype analysis across populations

    • Integration with other chloroplast markers for robust phylogenies

  • Evolutionary insights revealed:

    • Divergence patterns between cultivated and wild rice species

    • Population structure within O. nivara accessions

    • Evidence of selective pressure on functional domains

    • Correlation with geographical distribution patterns

  • Data analysis framework:

    • Maximum likelihood and Bayesian inference methods

    • Molecular clock calibration for dating divergence events

    • Tests for selection (dN/dS ratios)

    • Ancestral sequence reconstruction

Studies have identified a weak population structure with 59% admixtures among O. nivara accessions based on genome-wide SNP analysis, which includes variations in genes like atpI, providing insights into the evolutionary history of wild rice populations .

What insights does atpI provide about adaptation mechanisms in wild rice species?

Analysis of atpI sequences provides valuable insights into adaptation mechanisms in wild rice species:

  • Environmental adaptation signatures:

    • Sequence variations correlating with habitat conditions

    • Selection patterns in species from different ecological niches

    • Specific substitutions in species adapted to drought or flooding

    • Codon usage bias potentially reflecting adaptation to different environments

  • Functional implications:

    • Variations in proton channel residues affecting ATP synthesis efficiency

    • Adaptations potentially optimizing photosynthesis under specific light conditions

    • Modifications possibly conferring stress tolerance advantages

    • Structural adjustments potentially affecting thermal stability of the complex

  • Comparative analysis findings:

    • O. nivara-specific substitutions possibly related to drought adaptation

    • Differences between wild and cultivated species potentially reflecting domestication effects

    • Variation patterns suggesting local adaptation to diverse habitats

    • Conservation of critical functional domains despite environmental pressure

  • Integrative perspective:

    • Correlation with physiological adaptations in photosynthetic efficiency

    • Relationship between sequence variation and stress response mechanisms

    • Connection to reproductive strategies and life history traits

    • Insights into potential genetic resources for crop improvement

Genome-wide association studies in O. nivara have revealed genetic variations associated with important traits like silica content and disease resistance, suggesting that wild rice contains valuable genetic resources for improving cultivated varieties. Similarly, variations in atpI and other energy metabolism genes may contribute to important adaptive traits .

What bioinformatic approaches are most effective for analyzing atpI sequence and structure?

Effective bioinformatic analysis of atpI sequence and structure requires a multi-faceted approach:

  • Sequence analysis tools:

    • Multiple sequence alignment: MUSCLE, MAFFT, or T-Coffee for accurate alignment of atpI sequences

    • Conservation analysis: ConSurf or Sequence Harmony to identify functionally important residues

    • Transmembrane topology prediction: TMHMM, Phobius, or TOPCONS for membrane-spanning regions

    • Codon usage analysis: CodonW or GCUA to detect adaptation signatures

  • Structural prediction methods:

    • Homology modeling: MODELLER or SWISS-MODEL using related ATP synthase structures as templates

    • Ab initio modeling: AlphaFold2 for regions lacking homologous structures

    • Molecular dynamics simulations: GROMACS or NAMD with specialized membrane force fields

    • Model validation: ProCheck, WHAT_CHECK, or MolProbity

  • Functional prediction approaches:

    • Functional site prediction: DEPTH, ConCavity, or LIGSITE for identifying potential binding sites

    • Electrostatic analysis: APBS or DelPhi for proton channel properties

    • Conservation mapping: Evolutionary Trace or ET Viewer

    • Protein-protein interaction prediction: HADDOCK or ClusPro for subunit interactions

  • Evolutionary analysis methods:

    • Phylogenetic tree construction: MEGA, RAxML, or MrBayes

    • Selection pressure analysis: PAML or HyPhy

    • Ancestral sequence reconstruction: FastML or PAML

    • Population genetics analysis: DnaSP or ARLEQUIN

Researchers studying O. nivara populations have successfully employed tools like Structure v2.3.4 based on Bayesian clustering algorithms and GAPIT (Genome Association and Prediction Integrated Tool) package in R for analyzing genetic structure relevant to adaptation .

How can researchers integrate transcriptomic and proteomic data to understand atpI expression and regulation?

Integrating transcriptomic and proteomic data provides a comprehensive understanding of atpI expression and regulation:

  • Data generation approaches:

    • RNA-Seq for transcriptome profiling under various conditions

    • Quantitative proteomics (LC-MS/MS) for protein abundance measurement

    • Ribosome profiling to assess translation efficiency

    • Targeted RT-qPCR for validation of expression patterns

  • Integration methodologies:

    • Correlation analysis between transcript and protein levels

    • Pathway enrichment across multi-omic datasets

    • Time-course analysis to capture regulatory dynamics

    • Network analysis to identify co-regulated genes

  • Regulatory mechanism identification:

    • Promoter analysis for transcription factor binding sites

    • RNA stability assessment through decay rate measurement

    • Translational efficiency calculation from ribosome profiling

    • Post-translational modification mapping using MS/MS data

  • Visualization and interpretation tools:

    • Cytoscape for network visualization

    • R packages (DESeq2, limma) for differential expression analysis

    • Pathway analysis using KEGG or MapMan

    • Integrated visualization with tools like Pathview

Studies in rice have demonstrated that integrating transcriptomic data with functional analysis can reveal important connections between ATP metabolism and stress responses. For example, research identified differentially expressed genes related to ATP production in response to sheath blight disease, suggesting coordination between energy metabolism and defense responses .

What emerging technologies could advance our understanding of atpI function in ATP synthase?

Several emerging technologies hold promise for advancing our understanding of atpI function:

  • Advanced imaging techniques:

    • Cryogenic electron microscopy (cryo-EM) for high-resolution structural determination

    • Single-molecule FRET to observe conformational changes during function

    • Super-resolution microscopy for in situ localization and dynamics

    • High-speed atomic force microscopy for real-time conformational changes

  • Novel genetic engineering approaches:

    • Prime editing for precise chloroplast genome modification

    • Optogenetic control of ATP synthase activity

    • Synthetic biology approaches to create minimal ATP synthase systems

    • CRISPR-based technologies adapted for organelle targeting

  • Innovative biochemical methods:

    • Native mass spectrometry for intact complex analysis

    • Hydrogen-deuterium exchange mass spectrometry for dynamic interactions

    • Nanodiscs for functional reconstitution in defined lipid environments

    • Site-specific crosslinking combined with mass spectrometry for interaction mapping

  • Computational advances:

    • Quantum mechanics/molecular mechanics simulations of proton transfer

    • Machine learning approaches for predicting functional impacts of variations

    • Whole-cell modeling incorporating organelle energetics

    • Systems biology frameworks integrating multi-omics data

Recent advances in cryo-EM technology have revolutionized membrane protein structural biology, enabling visualization of complete ATP synthase complexes with unprecedented detail, and could be applied to understand the specific role of atpI within the complex .

How might atpI research contribute to developing climate-resilient rice varieties?

Research on atpI has significant potential to contribute to developing climate-resilient rice varieties:

Research has shown that enhanced ATP synthase activity can improve photosynthetic performance in rice, particularly under high CO₂ and high light conditions, suggesting that optimization of ATP synthase components like atpI could be valuable in developing varieties adapted to future climate scenarios .

What are the current knowledge gaps in understanding atpI function in rice ATP synthase?

Despite significant advances, several knowledge gaps remain in understanding atpI function:

Studies on ATP synthase assembly in various organisms suggest that while AtpI plays important roles in complex formation and stability, its precise function may vary between species and requires further investigation, particularly in plants where chloroplast ATP synthase has unique features .

What methodological advances are needed to overcome current research limitations?

Advancing atpI research requires several methodological innovations:

  • Genetic manipulation improvements:

    • More efficient chloroplast transformation systems for rice

    • Enhanced homologous recombination efficiency in plastids

    • Better selectable markers for organelle transformation

    • Improved tissue culture systems for regenerating transplastomic plants

  • Structural biology needs:

    • Optimization of membrane protein sample preparation for cryo-EM

    • Improvement in crystallization techniques for plant membrane proteins

    • Development of methods to capture dynamic states during function

    • Advanced computational approaches for modeling complete ATP synthase complexes

  • Functional analysis innovations:

    • Real-time measurement of proton translocation in intact chloroplasts

    • Single-molecule techniques adapted for thylakoid membrane proteins

    • Methods to manipulate ATP synthase activity in vivo with temporal control

    • Non-invasive imaging techniques for monitoring ATP synthesis in living plants

  • Systems biology approaches:

    • Integration of multi-omics data specific to organelle function

    • Development of mathematical models for chloroplast energetics

    • Improved tools for analyzing nuclear-organelle genetic interactions

    • Field-based phenotyping technologies to assess photosynthetic efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.