Recombinant Oryza nivara ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza nivara ATP Synthase Subunit b, Chloroplastic (atpF)

Recombinant Oryza nivara ATP synthase subunit b, chloroplastic (atpF), is a component of the ATP synthase complex found in chloroplasts. This enzyme plays a crucial role in photosynthesis by generating ATP from ADP and inorganic phosphate using the energy derived from a proton gradient across the thylakoid membrane. The recombinant form of this subunit is produced through genetic engineering techniques, allowing for its expression in host organisms like bacteria, which facilitates its purification and study.

Structure and Function

The ATP synthase complex in chloroplasts is composed of two main parts: the membrane-bound F₀ sector and the soluble F₁ sector. The F₀ sector includes subunits like atpF (subunit b), which are integral to the thylakoid membrane and are involved in proton translocation. This process drives the rotation of the stalk subunits, which in turn drives the synthesis of ATP in the F₁ sector.

SubunitFunction
atpF (b)Part of the F₀ sector; involved in proton translocation across the thylakoid membrane.
atpI (a)Also part of the F₀ sector; plays a crucial role in proton translocation and ATP synthesis.
atpH (c)Forms a ring structure in the F₀ sector; essential for the mechanical coupling of proton flow to ATP synthesis.

Recombinant Production

Recombinant production of the atpF subunit involves cloning the gene encoding this subunit into an expression vector, which is then introduced into a host organism such as Escherichia coli. The host organism expresses the protein, which can be purified using various biochemical techniques.

Recombinant Production Steps:

  1. Cloning: The gene encoding the atpF subunit is cloned into an appropriate expression vector.

  2. Transformation: The vector is introduced into a host organism like E. coli.

  3. Expression: The host organism expresses the recombinant protein.

  4. Purification: Techniques such as affinity chromatography or gel filtration are used to isolate the protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
atpF
Target Protein Sequence
MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIYFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTIEQLEKARIRLQKVELEADEYRMNGYSEIEREKANLINATSISLEQ LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANISILGAME WKS
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F(1), the extramembrane catalytic core, and F(0), the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) and F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Oryza nivara and why is it significant in ATP synthase research?

Oryza nivara is an annual wild rice species that serves as one of the domestication ancestors of cultivated rice (Oryza sativa) . It possesses tremendous allelic variation that has been utilized for breeding economically important traits in rice . O. nivara is particularly valuable in evolutionary studies as it forms a sister group to the aus subgroup of rice . In ATP synthase research, O. nivara provides an important model for understanding the structure, function, and evolution of chloroplastic energy production systems in wild relatives of crop species. The study of its ATP synthase components offers insights into both fundamental biological processes and potential applications in crop improvement.

What is the function of ATP synthase subunit b (atpF) in chloroplasts?

ATP synthase subunit b, encoded by the atpF gene, is a critical component of the chloroplastic ATP synthase complex that produces adenosine triphosphate (ATP) required for photosynthetic metabolism . The b subunit forms part of the peripheral stalk (or stator) of the ATP synthase, which connects the membrane-embedded F₀ portion to the catalytic F₁ portion of the enzyme. This structural connection is essential for preventing the rotation of the F₁ portion during ATP synthesis, thereby allowing the mechanical energy from proton translocation to be efficiently converted into chemical energy in the form of ATP. The subunit b helps maintain the structural integrity of the complex during the rotational catalysis mechanism driven by the proton gradient across the thylakoid membrane.

How does recombinant Oryza nivara atpF differ from native protein?

Recombinant Oryza nivara ATP synthase subunit b typically contains modifications that facilitate its expression, purification, and subsequent research applications, while maintaining the core structure and function of the native protein. Key differences include:

FeatureNative atpF ProteinRecombinant atpF Protein
SourceExtracted from O. nivara plantsProduced in expression systems (E. coli, etc.)
PurityMixed with other chloroplast proteinsCan be purified to high homogeneity
YieldLimited by plant material availabilityPotentially higher yields through optimization
ModificationsNoneMay include affinity tags, cleavage sites
Post-translational modificationsNatural plant modificationsMay lack plant-specific modifications
Structural integrityComplete native structureMay require refolding depending on expression system

These differences must be considered when designing experiments using recombinant atpF, particularly when studying structure-function relationships or protein-protein interactions.

What are the most effective expression systems for recombinant Oryza nivara atpF production?

Similar to other chloroplastic proteins, recombinant O. nivara atpF can be produced using several expression systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsYield Potential
E. coliRapid growth, high yields, simple geneticsLacks post-translational modifications, inclusion body formationHigh (5-50 mg/L)
Yeast (P. pastoris)Eukaryotic system, secretion possibleLonger production time, more complex mediaModerate (1-10 mg/L)
Insect cellsBetter folding for complex proteinsExpensive, technically demandingModerate (1-5 mg/L)
Plant-based systemsNative-like modificationsLow yields, time-consumingLow (0.1-1 mg/L)

For most research applications, E. coli remains the preferred system for atpF expression due to its efficiency and cost-effectiveness . When expressing atpF in E. coli, codon optimization for the host organism significantly improves yields, as the codon usage between Oryza nivara and E. coli differs considerably. Additionally, expression as a fusion protein (e.g., with MBP, GST, or SUMO) often enhances solubility and simplifies purification.

What are the critical factors affecting successful gene synthesis for recombinant atpF expression?

Successful recombinant atpF expression begins with proper gene synthesis. Critical factors include:

  • Codon optimization: Adjusting codons to match the preferred usage in the expression host (e.g., E. coli) significantly improves translation efficiency and protein yield.

  • Gene assembly strategy: Similar to the approach described for ATP synthase subunit c, the atpF gene can be constructed by annealing and ligating overlapping oligonucleotides . For atpF, typically 14-20 overlapping oligonucleotides ranging from 25-50 bp would be required.

  • 5' and 3' regulatory elements: Inclusion of appropriate ribosome binding sites and transcription terminators enhances expression.

  • Restriction site management: Strategic placement of restriction sites facilitates cloning while avoiding sites within the coding sequence.

  • Signal sequence modifications: For chloroplastic proteins like atpF, removal or replacement of the transit peptide may be necessary for proper expression in heterologous systems.

When synthesizing the atpF gene, it's advisable to add phosphates to the 5' end of all individual oligonucleotides (except the 5' terminus oligonucleotides) using T4 Polynucleotide Kinase before annealing, as demonstrated in protocols for similar ATP synthase subunits .

What purification strategy yields the highest purity recombinant Oryza nivara atpF?

A multi-step purification strategy typically yields the highest purity recombinant O. nivara atpF:

  • Initial capture: Affinity chromatography using an appropriate tag (His-tag, MBP-tag, etc.) provides selective capture of the target protein.

  • Intermediate purification: Ion exchange chromatography (IEX) separates proteins based on charge differences. For atpF with a predicted pI of ~9.2, cation exchange chromatography is effective.

  • Polishing: Size exclusion chromatography (SEC) removes aggregates and provides buffer exchange.

  • Tag removal: If necessary, proteolytic cleavage of fusion tags followed by a second affinity step.

For membrane-associated proteins like atpF, including detergents in the purification buffers is often necessary. A common workflow uses 0.5-1% DDM (n-Dodecyl β-D-maltoside) or LDAO (Lauryldimethylamine oxide) during extraction, reducing to 0.05-0.1% in later purification steps.

How can researchers overcome inclusion body formation when expressing Oryza nivara atpF?

Inclusion body formation is a common challenge when expressing membrane-associated proteins like atpF. Strategies to overcome this include:

If inclusion bodies still form despite these preventative measures, on-column refolding during affinity purification often yields functional protein. This involves binding the denatured protein (in 6-8M urea or 6M guanidine hydrochloride) to the affinity resin, followed by a gradual reduction in denaturant concentration through a linear gradient.

What techniques are most effective for assessing the structural integrity of purified recombinant atpF?

Multiple complementary techniques provide comprehensive structural characterization of recombinant atpF:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content (α-helices and β-sheets). For atpF, which contains predominantly α-helical structures, CD spectra should show characteristic minima at 208 and 222 nm.

  • Thermal Shift Assays: Measures protein stability through unfolding transitions. Properly folded atpF typically shows cooperative unfolding with a defined melting temperature (Tm).

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the oligomeric state and homogeneity of the purified protein.

  • Limited Proteolysis: Correctly folded proteins show resistance to proteolytic digestion at low protease concentrations.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For advanced structural characterization, 1D ¹H-NMR provides a fingerprint of properly folded protein through well-dispersed signals.

For membrane proteins like atpF, these techniques must be adapted to accommodate the presence of detergents or lipids in the buffer systems.

How can researchers evaluate the functional activity of recombinant Oryza nivara atpF?

Functional characterization of recombinant atpF requires assessing its ability to integrate into the ATP synthase complex and support ATP synthesis. Key approaches include:

  • Reconstitution Assays: Incorporating purified atpF into liposomes or nanodiscs along with other ATP synthase components to measure ATP synthesis activity.

  • Binding Assays: Using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify interactions between atpF and other subunits of the ATP synthase complex.

  • ATPase Activity: While atpF itself doesn't have enzymatic activity, its ability to modulate the ATPase activity of the F₁ portion when incorporated into the complex can be measured using coupled enzyme assays.

  • Complementation Studies: Expressing recombinant atpF in atpF-deficient mutant systems to assess functional rescue.

For quantitative assessment, ATP synthesis activity can be measured using a luciferase-based ATP detection system after establishing a proton gradient across reconstituted proteoliposomes containing the assembled ATP synthase complex.

How is recombinant Oryza nivara atpF utilized in evolutionary studies of rice species?

Recombinant O. nivara atpF serves as a valuable tool in evolutionary studies of rice species through several applications:

  • Comparative Structural Analysis: Structural comparisons between atpF from O. nivara and other Oryza species help identify conserved regions important for function versus species-specific adaptations. This is particularly relevant given that O. nivara is considered one of the domestication ancestors of cultivated rice (O. sativa) .

  • Phylogenetic Marker Development: The atpF gene and protein sequences provide phylogenetic markers for studying the evolutionary relationships among Oryza species, complementing genomic approaches that have identified weak population structure with 59% admixtures among O. nivara accessions .

  • Functional Conservation Studies: Functional studies comparing ATP synthase activity across recombinant atpF proteins from different rice species help determine how conserved or divergent the energy production machinery is across the Oryza genus.

  • Adaptation Analysis: Comparing atpF sequences and structures from rice species adapted to different environments reveals potential adaptations in ATP synthase function related to environmental stress tolerance.

These approaches have contributed to understanding the broader evolutionary context of ATP synthase in plants, including the independent origins of indica and japonica rice varieties .

What role does recombinant atpF research play in understanding cytoplasmic male sterility in rice?

Recombinant atpF research contributes significantly to understanding cytoplasmic male sterility (CMS) in rice, a trait important for hybrid seed production:

  • Structural Interactions: Recombinant atpF enables studies of interactions between ATP synthase components and CMS-associated mitochondrial genes like orfH79. Research has shown that B-atp6-orfH79 and its variants exist in multiple Oryza species including O. nivara .

  • Chimeric Gene Analysis: Studies have revealed that orfH79 is always accompanied by B-atp6, forming a chimeric structure important for CMS . Recombinant atpF research helps elucidate how ATP synthase subunits may interact with these chimeric structures.

  • Species-Specific Variations: Analysis of atpF and other ATP synthase components across Oryza species, including O. nivara, has identified species-specific variations that may influence compatibility with CMS factors.

  • Restoration Mechanisms: Recombinant atpF allows for investigation of how fertility restorer genes interact with ATP synthase components to overcome CMS, particularly relevant given that specific fertility restorers correspond to variant orfH79 haplotypes .

Understanding these relationships has practical applications in rice breeding programs by providing molecular markers for CMS traits and identifying novel CMS sources from wild rice species like O. nivara.

How can researchers resolve protein degradation issues during purification of recombinant atpF?

Protein degradation during purification of recombinant atpF can be addressed through several strategies:

ProblemSolutionImplementation
Proteolytic degradationProtease inhibitor cocktailAdd 1X commercial protease inhibitor mixture to all buffers
Reduced temperaturePerform all purification steps at 4°C
EDTA additionInclude 1-5 mM EDTA to inhibit metalloproteases
C-terminal degradationC-terminal fusion tagsPlace affinity tags at C-terminus
Terminal stabilizationAdd proline residues near C-terminus
N-terminal degradationN-terminal fusion tagsUse MBP or SUMO as N-terminal fusion partners
General instabilityBuffer optimizationScreen various pH values (7.0-8.5) and salt concentrations (100-500 mM NaCl)
Stabilizing additivesInclude glycerol (10-20%), sucrose (5-10%), or arginine (50-100 mM)

For particularly challenging cases, pulse-chase purification approaches can be effective, where the protein is rapidly purified in smaller batches and immediately used for downstream applications rather than stored for extended periods.

What strategies can be employed when recombinant atpF fails to interact with other ATP synthase components?

When recombinant atpF fails to interact with other ATP synthase components, consider these troubleshooting approaches:

  • Verify protein folding: Ensure atpF has proper secondary structure using CD spectroscopy before attempting interaction studies.

  • Buffer optimization: Systematic screening of buffer conditions (pH 6.5-8.5, NaCl 50-500 mM) and detergents (DDM, LDAO, LMNG) often reveals optimal conditions for protein-protein interactions.

  • Tag interference assessment: If affinity tags are present, they may interfere with interactions. Compare tagged versus untagged versions or move tags to different positions.

  • Co-expression approach: Instead of attempting to reconstitute interactions from individually purified components, co-express atpF with its interaction partners, which often promotes proper complex formation during expression.

  • Lipid supplementation: For membrane proteins like atpF, specific lipids may be required for proper interaction. Supplement with plant thylakoid membrane lipids (MGDG, DGDG) at 0.01-0.1 mg/mL.

A methodical approach combining these strategies typically resolves interaction challenges, with particular attention to the membrane environment being crucial for ATP synthase components.

How can site-directed mutagenesis of recombinant atpF advance understanding of ATP synthase function?

Site-directed mutagenesis of recombinant O. nivara atpF provides a powerful approach to dissect structure-function relationships in ATP synthase:

  • Stator function analysis: Mutations in the b-subunit regions that interact with the α₃β₃ hexamer can reveal the mechanical principles of how the stator prevents rotation of the F₁ portion during ATP synthesis.

  • Species-specific residue investigation: Comparing sequences of atpF from O. nivara with other Oryza species identifies species-specific residues that can be mutated to determine their functional significance, particularly relevant given O. nivara's position as a domestication ancestor of cultivated rice .

  • Inter-subunit interaction mapping: Systematic mutation of residues at interfaces between atpF and other subunits helps map the contact points critical for complex assembly and stability.

  • Proton translocation coupling: Strategic mutations can help elucidate how the b-subunit contributes to coupling proton translocation through the membrane domain to ATP synthesis in the catalytic domain.

For rigorous analysis, mutational studies should include both conservative and non-conservative substitutions, with functional assays measuring both ATP synthesis activity and complex stability to distinguish between effects on catalysis versus assembly.

What are the current technical limitations in crystallizing recombinant atpF and how might they be overcome?

Crystallizing membrane proteins like recombinant atpF presents significant challenges that can be addressed through innovative approaches:

ChallengeAdvanced SolutionTechnical Details
Conformational heterogeneityNanobody stabilizationGenerate camelid antibody fragments that lock atpF in specific conformations
Conformation-specific crosslinkingIntroduce paired cysteine residues that form disulfide bonds in specific conformations
Hydrophobic surfacesFusion with crystallization chaperonesFuse atpF with T4 lysozyme or BRIL at loop regions to provide crystal contacts
Lipidic cubic phase crystallizationEmbed protein in monoolein-based mesophases at 2:3 protein:lipid ratio
Low protein yieldSynthetic gene optimizationDesign synthetic genes with reduced rare codons and optimized mRNA secondary structure
High-cell-density fermentationImplement fed-batch processes in bioreactors to achieve cell densities >100 OD₆₀₀
Detergent interferenceAmphipol substitutionReplace conventional detergents with amphipathic polymers like A8-35 or PMAL-C8
Nanodisc incorporationReconstitute atpF into MSP1D1 nanodiscs with native-like lipid bilayers

Recent advances in cryo-electron microscopy (cryo-EM) offer an alternative approach that may bypass crystallization entirely. For atpF specifically, single-particle cryo-EM of the entire ATP synthase complex reconstituted with the recombinant subunit allows structural determination without crystallization, potentially at resolutions approaching 3Å.

How does comparative analysis of atpF across Oryza species inform our understanding of chloroplast evolution?

Comparative analysis of atpF across Oryza species provides valuable insights into chloroplast evolution:

  • Selective pressure mapping: By analyzing the ratio of non-synonymous to synonymous substitutions (dN/dS) across the atpF sequence in different Oryza species, researchers can identify regions under positive or purifying selection. These analyses have revealed that O. nivara's position as a sister group to the aus subgroup of rice is reflected in its atpF sequence conservation patterns.

  • Co-evolution with nuclear genes: The chloroplast-encoded atpF interacts with nuclear-encoded ATP synthase subunits, creating opportunities to study co-evolution between the nuclear and chloroplast genomes. This is particularly relevant in O. nivara, which has shown weak population structure with significant admixtures .

  • Intron evolution: The atpF gene typically contains an intron in land plants, and comparative analysis of this intron across Oryza species reveals patterns of conservation and divergence that inform our understanding of chloroplast genome evolution.

  • Horizontal gene transfer assessment: Detailed sequence analysis of atpF across Oryza species can reveal potential horizontal gene transfer events, similar to the multicentric origin and diversification observed in atp6-orf79-like structures in mitochondrial genomes .

These comparative approaches, enabled by recombinant expression systems, contribute to our understanding of how chloroplast genomes have evolved during the domestication and diversification of rice species from wild ancestors like O. nivara.

What emerging technologies could revolutionize recombinant atpF research?

Several cutting-edge technologies are poised to transform recombinant atpF research:

  • Cell-free protein synthesis systems: Advanced cell-free expression platforms specifically optimized for membrane proteins can produce atpF directly in artificial membrane environments, bypassing inclusion body formation and refolding challenges.

  • Cryo-electron tomography: This technique allows visualization of ATP synthase complexes containing recombinant atpF within their native membrane environment, providing insights into the spatial organization and interactions impossible to observe with traditional structural methods.

  • Computational protein design: Machine learning algorithms trained on ATP synthase structures across species can predict modifications to atpF that enhance stability or alter function in specified ways, guiding experimental design.

  • In-cell NMR spectroscopy: This emerging approach enables structural and dynamic studies of atpF within living cells, providing insights into how the protein behaves in its native environment.

  • High-throughput mutagenesis with deep mutational scanning: This approach enables systematic analysis of thousands of atpF variants simultaneously, creating comprehensive maps of sequence-function relationships.

These technologies, when applied to recombinant O. nivara atpF research, will provide unprecedented insights into ATP synthase structure, function, and evolution across the Oryza genus.

How might recombinant atpF research contribute to crop improvement strategies?

Recombinant atpF research has several potential applications in crop improvement:

  • Energy efficiency engineering: Understanding the structure-function relationships of ATP synthase through recombinant atpF studies could lead to modifications that enhance photosynthetic efficiency by optimizing the ATP/proton ratio, potentially increasing crop yields.

  • Stress tolerance improvement: Comparative studies of atpF from stress-tolerant wild relatives like O. nivara could identify adaptations that enhance ATP synthase function under stress conditions, which could be introduced into cultivated varieties.

  • Hybrid vigor mechanisms: Research on recombinant atpF interactions with cytoplasmic male sterility factors like orfH79 contributes to our understanding of compatibility between nuclear and organellar genomes, which underlies hybrid vigor in rice.

  • Molecular marker development: Structural and functional insights from recombinant atpF research can lead to the development of molecular markers for traits related to energy metabolism efficiency, applicable in marker-assisted selection breeding programs.

  • Synthetic biology approaches: Detailed understanding of atpF structure and function enables rational design of synthetic ATP synthase variants with novel properties, potentially creating crops with enhanced growth characteristics or ability to thrive in marginal environments.

These applications demonstrate how fundamental research on recombinant atpF contributes to the broader goal of developing more productive, resilient crop varieties to address global food security challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.