Recombinant Oryza nivara Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Functional Roles of cemA in Chloroplast Physiology

cemA is integral to chloroplast envelope membranes, facilitating critical processes:

  • Ion and Metabolite Transport: Directly regulates pH homeostasis via proton antiport activity, essential for stromal pH balance during photosynthesis .

  • Membrane Biogenesis: Participates in lipid trafficking and bilayer assembly, particularly for galactolipids unique to chloroplast membranes .

  • Stress Response: Associates with oxidative stress management systems, including thioredoxin-linked pathways .

Studies in Arabidopsis homologs suggest cemA interacts with TOC/TIC translocon components, implying a role in protein import .

Production and Purification of Recombinant cemA

Recombinant cemA is typically produced using the following workflow:

Expression Systems

  • Prokaryotic: E. coli BL21(DE3) with IPTG induction .

  • Eukaryotic: Baculovirus/insect cell systems for post-translational modifications .

Purification Methods

  • Affinity chromatography (Ni-NTA for His-tagged variants) .

  • Gel filtration to isolate monomeric forms .

Yield and Stability

  • Typical yields: 1–5 mg/L culture .

  • Storage: Tris-based buffer with 50% glycerol at -80°C; avoid freeze-thaw cycles .

Enzymatic and Binding Assays

Recombinant cemA has been utilized to:

  • Characterize Mg²⁺/H⁺ antiport kinetics (Kₘ: 0.8 mM for Mg²⁺) .

  • Map protein-protein interaction networks via crosslinking-MS, identifying partners like Tic110 and Tic55 .

Hybridization Studies

Interspecific hybrids (O. sativa × O. nivara) exhibit upregulated cemA expression correlated with enhanced seed protein content (+28% vs. parental lines) . SDS-PAGE profiles show increased 13–14 kDa polypeptides (prolamins/glutelins) in hybrid seeds :

GenotypeTotal Protein (%)Lysine Content (g/100g)
O. nivara10.54.2
IR64 (O. sativa)9.73.6
Hybrid (IR64 × O. nivara)12.44.8

Challenges and Future Directions

  • Low Abundance: Native cemA constitutes <0.1% of envelope proteome, necessitating overexpression for structural studies .

  • Membrane Integration: Refolding protocols for E. coli-expressed cemA require optimization to preserve activity .

  • CRISPR-Based Studies: Targeted knockout in O. nivara could elucidate cemA’s role in stress adaptation and hybrid vigor .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please clearly indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery timelines, please contact your local distributor.
Note: Our standard shipping includes blue ice packs. If you require dry ice for transportation, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development for your order.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
cemA
Target Protein Sequence
MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSQTLLTAIQEKRVLERF MELEDLFILDEMIKEKPNTHVQNPPIGIRKEIIQLAKIDNEGHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSVKAFFILLVTDFFVGFHSTRGWELLIRWVYND LGWVPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the Oryza nivara Chloroplast envelope membrane protein (cemA) and what are its basic structural features?

Chloroplast envelope membrane protein (cemA), also known as ycf10, is a protein encoded by the chloroplast genome of Oryza nivara (Indian wild rice). It is a full-length protein consisting of 230 amino acids that functions within the chloroplast envelope membrane system. The protein contains multiple hydrophobic regions consistent with a membrane-integrated structure and has a UniProt accession number of Q6ENG1. The complete amino acid sequence reveals a complex protein with potentially multiple transmembrane domains characteristic of membrane transport or structural proteins .

The protein's primary structure includes regions rich in hydrophobic amino acids that likely form membrane-spanning segments, interspersed with hydrophilic domains that may project into either the stroma or intermembrane space. The presence of specific sequence motifs suggests potential functional roles in membrane organization or molecular transport across the chloroplast envelope.

How does cemA from Oryza nivara compare with homologous proteins in other plant species?

Evolutionary analysis suggests that cemA has been under selective pressure in wild rice varieties, potentially contributing to the adaptive traits that have made O. nivara valuable in rice breeding programs. The protein's conservation within the chloroplast genome (which typically evolves more slowly than nuclear genes) indicates its essential function in photosynthetic metabolism or chloroplast membrane organization.

What are the recommended storage and handling conditions for recombinant cemA protein?

For optimal stability and activity of recombinant Oryza nivara cemA protein, storage at -20°C is recommended, with extended storage preferably at -80°C. The protein is typically stored in a Tris-based buffer with 50% glycerol that has been optimized for stability . Repeated freeze-thaw cycles should be avoided to prevent protein degradation and loss of activity.

Working aliquots can be maintained at 4°C for up to one week, but longer-term storage requires freezing conditions. When handling the protein, consideration should be given to its membrane-associated nature, which may require the presence of detergents or other stabilizing agents to maintain its native conformation and prevent aggregation.

PropertyDescription
Storage Temperature-20°C (short-term), -80°C (long-term)
Buffer CompositionTris-based buffer with 50% glycerol
Recommended HandlingAvoid repeated freeze-thaw cycles
Working Storage4°C for up to one week
Protein TagTag type determined during production process

What expression systems are most effective for recombinant production of cemA?

The optimal expression system for cemA must address the challenges inherent in producing membrane proteins, which often face folding and toxicity issues in heterologous hosts. While bacterial systems like E. coli may offer high yields and simplicity, the hydrophobic transmembrane domains of cemA can lead to inclusion body formation, requiring refolding protocols that may compromise protein activity .

Eukaryotic expression systems including yeast (P. pastoris, S. cerevisiae), insect cells (using baculovirus vectors), or plant-based systems may provide superior folding environments for cemA. The choice between these systems should consider factors including post-translational modification requirements, expression yield, and downstream purification compatibility.

For systematic optimization of expression conditions, Design of Experiments (DoE) approaches should be employed rather than one-factor-at-a-time methods, as DoE allows evaluation of interactive effects between multiple parameters (temperature, inducer concentration, host strain, etc.) with minimal experimental runs . These approaches are particularly valuable for membrane proteins like cemA where multiple factors may significantly impact expression success.

What purification strategies yield the highest purity and functional integrity for recombinant cemA?

Purification of cemA requires specialized approaches that maintain the protein's membrane-associated structure. Initial extraction typically employs detergents (e.g., DDM, LDAO, or FC-12) carefully selected to solubilize the protein while preserving its native conformation. Affinity chromatography utilizing fusion tags is the primary capture step, followed by additional purification techniques .

A comprehensive purification strategy might include:

  • Membrane isolation from expression host cells through differential centrifugation

  • Detergent solubilization screening to identify optimal extraction conditions

  • Immobilized metal affinity chromatography (IMAC) utilizing histidine or other fusion tags

  • Size exclusion chromatography to remove aggregates and impurities

  • Optional ion-exchange chromatography for further purification

  • Quality assessment through SDS-PAGE, Western blotting, and activity assays

Each purification step should be optimized using DoE approaches to balance yield, purity, and retention of functional properties. The selection of detergents and buffer components is particularly critical for maintaining the protein's structural integrity throughout the purification process.

How can researchers verify the proper folding and functionality of purified recombinant cemA?

Verifying proper folding and functionality of purified cemA requires multiple complementary approaches, as traditional enzyme activity assays may not be applicable to membrane structural proteins. Circular dichroism (CD) spectroscopy provides information about secondary structure content, while fluorescence spectroscopy can assess tertiary structure integrity through intrinsic tryptophan fluorescence.

For membrane proteins like cemA, functional verification may require:

  • Reconstitution into lipid bilayers or nanodiscs to assess membrane integration

  • Thermal stability assays to evaluate structural integrity

  • Binding assays with potential interaction partners

  • Structural analysis through electron microscopy or X-ray crystallography

  • In vivo complementation studies in model systems

Integration of multiple analytical techniques provides a comprehensive assessment of protein quality, as no single method can definitively confirm proper folding of complex membrane proteins like cemA.

How can researchers employ Design of Experiments (DoE) approaches to optimize cemA expression and purification?

Design of Experiments offers significant advantages over traditional optimization methods for recombinant cemA research. Unlike one-factor-at-a-time approaches, DoE efficiently evaluates multiple parameters simultaneously, revealing both individual factor effects and their interactions. For cemA expression, relevant factors include temperature, inducer concentration, host strain, media composition, and induction timing .

Implementation involves:

  • Identifying critical factors and their ranges based on literature and preliminary experiments

  • Selecting an appropriate experimental design (e.g., factorial, response surface methodology)

  • Conducting experiments with randomization to minimize bias

  • Analyzing results using statistical software to generate predictive models

  • Validating optimal conditions through confirmation runs

Response surface methodology is particularly valuable for optimizing continuous variables, generating mathematical models that predict optimal conditions. Several software packages facilitate DoE implementation, supporting experimental design selection, execution planning, and results analysis .

This systematic approach is especially valuable for cemA research where the hydrophobic nature of the protein makes expression and purification particularly challenging, and where multiple factors may interact in complex ways to influence outcomes.

What specialized techniques are required to study the membrane topology and protein-protein interactions of cemA?

Understanding cemA's membrane topology and interaction network requires specialized techniques adapted for membrane proteins. Topology mapping may employ:

  • Substituted cysteine accessibility methods (SCAM) to identify exposed residues

  • Protease protection assays to determine domain orientation

  • Fluorescence resonance energy transfer (FRET) to measure distances between domains

  • Computational prediction combined with experimental validation

For protein-protein interaction studies, conventional methods must be modified to accommodate cemA's membrane-integrated nature:

  • Chemical crosslinking followed by mass spectrometry to capture transient interactions

  • Split-ubiquitin or MYTH (membrane yeast two-hybrid) systems specifically designed for membrane proteins

  • Co-immunoprecipitation with carefully selected detergents to maintain complex integrity

  • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins in vivo

These approaches must be carefully optimized for cemA's specific properties, including its chloroplast localization and membrane integration. Experimental design should include appropriate controls to distinguish specific interactions from background associations commonly observed with hydrophobic membrane proteins.

What bioinformatic approaches can predict functional domains and evolutionary relationships of cemA?

Comprehensive bioinformatic analysis of cemA requires multiple computational approaches to overcome the limitations of individual prediction methods for membrane proteins. Sequence-based analyses should include:

  • Transmembrane domain prediction using algorithms specifically optimized for plant chloroplast proteins

  • Identification of conserved motifs through multiple sequence alignment across diverse plant species

  • Evolutionary rate analysis to identify functionally constrained regions

  • Coevolution analysis to detect potential interaction interfaces

Structure-based predictions may incorporate:

  • Homology modeling based on structurally characterized membrane proteins

  • Ab initio modeling for regions lacking suitable templates

  • Molecular dynamics simulations to evaluate structural stability

  • Docking studies with potential interaction partners

Integration of these approaches with experimental data enables iterative refinement of functional predictions. Particular attention should be paid to regions showing evolutionary conservation across diverse plant species, as these likely represent functionally critical domains that have been maintained through selective pressure.

What is known about the role of cemA in chloroplast function and plant physiology?

Current understanding of cemA's physiological role remains incomplete, with evidence suggesting involvement in chloroplast membrane organization and potentially in stress response pathways. The protein's chloroplast localization and membrane integration point to functions in organellar membrane structure or transport processes. Comparative analysis with homologs in other plant species suggests conservation of core functions with potential species-specific adaptations.

In Oryza nivara, cemA may contribute to the species' notable stress resistance traits, particularly its documented resistance to grassy stunt virus and sheath blight . This connection is particularly significant as O. nivara has served as a valuable source of resistance genes for cultivated rice breeding programs. The protein's conservation within the chloroplast genome, which typically contains genes essential for photosynthesis and basic chloroplast functions, further emphasizes its likely fundamental role in plant physiology.

Comprehensive functional characterization requires integration of structural studies, interaction mapping, and phenotypic analysis of plants with altered cemA expression or structure.

How does the genetic context of Oryza nivara influence cemA function compared to other rice species?

Oryza nivara, with its 12 chromosomes and 448 Mb nuclear genome, has evolved distinct adaptations to environmental stressors that differentiate it from cultivated rice varieties . The genetic context surrounding cemA likely influences its function through:

  • Potential interactions with nuclear-encoded proteins that may differ between rice species

  • Regulatory networks governing chloroplast gene expression that may show species-specific variations

  • Differences in post-translational modification systems that could affect cemA processing

  • Variations in chloroplast membrane composition that may alter cemA's structural environment

The documented ability of O. nivara to contribute resistance to grassy stunt virus to cultivated rice suggests that components of its stress response systems, potentially including chloroplast membrane proteins like cemA, have evolved effective mechanisms for pathogen resistance . Understanding how cemA functions within this genetic context provides valuable insights for both fundamental research and agricultural applications.

What experimental approaches can elucidate the potential role of cemA in stress response pathways?

Investigating cemA's involvement in stress responses requires multilevel experimental approaches that span molecular, cellular, and whole-plant analyses. Key methodologies include:

  • Comparative expression analysis of cemA under various stress conditions (pathogen exposure, abiotic stressors) using qRT-PCR or RNA-seq

  • Generation of transgenic plants with altered cemA expression to assess impact on stress phenotypes

  • Protein interaction studies under normal and stress conditions to identify stress-specific protein complexes

  • Metabolomic analysis to detect changes in chloroplast-associated metabolites when cemA expression is modified

  • Chloroplast membrane integrity assessments under stress conditions in plants with altered cemA function

For specifically investigating the connection to grassy stunt virus resistance, experimental designs should include:

  • Virus challenge assays comparing wild-type and cemA-modified plants

  • Analysis of chloroplast structural changes during viral infection

  • Assessment of cemA protein dynamics during pathogen exposure

  • Identification of viral components that potentially interact with chloroplast membranes

These approaches should be implemented in both Oryza nivara and cultivated rice varieties to elucidate species-specific aspects of cemA function in stress response mechanisms.

What are the primary technical challenges in studying cemA function?

Research on cemA faces several significant technical challenges that have limited comprehensive functional characterization:

  • Membrane protein expression difficulties, including protein misfolding, aggregation, and toxicity to host cells during recombinant production

  • Complex purification requirements necessitating specialized detergents and careful optimization to maintain structural integrity

  • Limited availability of structural information due to challenges in crystallizing membrane proteins

  • Difficulties in generating targeted modifications to chloroplast-encoded genes compared to nuclear genes

  • Potential functional redundancy that may mask phenotypes in single-gene studies

Overcoming these challenges requires integrated approaches that combine advanced molecular techniques with careful experimental design. The application of Design of Experiments methodologies is particularly valuable for systematically addressing the complex parameter space involved in membrane protein research .

How might emerging technologies advance our understanding of cemA structure and function?

Recent technological advances offer promising new approaches for cemA research:

  • Cryo-electron microscopy advancements now enable structural determination of membrane proteins previously resistant to crystallization

  • Native mass spectrometry techniques adapted for membrane proteins can reveal protein complexes in near-native states

  • Advanced genetic engineering tools, including chloroplast-targeted CRISPR systems, allow precise manipulation of plastid genes

  • Single-molecule techniques provide insights into protein dynamics and heterogeneity obscured in bulk measurements

  • Artificial intelligence approaches for structure prediction (e.g., AlphaFold) are increasingly capable of modeling membrane proteins

These technologies, applied in combination, have the potential to resolve longstanding questions about cemA's structure, interactions, and functional roles. Particularly promising is the integration of structural biology approaches with functional genomics and phenotypic analyses to connect molecular mechanisms with physiological outcomes.

What potential applications might emerge from advanced understanding of cemA function?

Elucidating cemA's function could have significant implications for both fundamental research and applied agricultural biotechnology:

  • Enhanced understanding of chloroplast membrane organization and biogenesis mechanisms

  • New insights into chloroplast-nuclear communication pathways

  • Potential targets for improving photosynthetic efficiency or stress resilience in crops

  • Novel strategies for engineering disease resistance, particularly against viruses affecting rice production

  • Improved models of chloroplast evolution and the functional significance of plastid-encoded genes

Given O. nivara's documented contribution of resistance traits to cultivated rice, particularly against the grassy stunt virus , understanding cemA's potential role in these mechanisms could inform targeted breeding or biotechnological approaches to crop improvement. If cemA proves to be involved in membrane-associated defense responses, this knowledge could open new avenues for enhancing crop protection against emerging pathogens.

What methodological workflow is recommended for initial characterization of cemA function?

A systematic approach to cemA characterization should progress through several phases:

  • Preparatory Phase:

    • Bioinformatic analysis of sequence and predicted structure

    • Identification of suitable expression systems and purification strategies

    • Design of Experiments planning for optimization of production conditions

  • Production Phase:

    • Recombinant expression optimization using DoE approaches

    • Development of purification protocols maintaining protein stability

    • Quality control assessments including verification of proper folding

  • Structural Characterization:

    • Membrane topology mapping using complementary techniques

    • Structural analysis through appropriate methods (cryo-EM, spectroscopy)

    • Computational modeling integrated with experimental data

  • Functional Analysis:

    • Interaction partner identification through multiple complementary methods

    • Functional assays based on predicted roles

    • Generation of modified plants for phenotypic analysis

  • Physiological Integration:

    • Stress response studies under controlled conditions

    • Comparative analysis across rice species with differing stress tolerances

    • Systems-level analysis integrating multiple data types

This workflow employs Design of Experiments approaches at multiple stages to efficiently optimize experimental conditions, particularly for challenging steps like membrane protein expression and purification .

How should researchers interpret and reconcile potentially contradictory data regarding cemA function?

When facing contradictory results in cemA research, a systematic analytical framework is essential:

  • Methodological Analysis:

    • Evaluate differences in experimental systems (in vitro vs. in vivo, heterologous vs. native)

    • Assess technical variations in protein preparation (detergents, buffer conditions)

    • Consider differences in measurement techniques and their limitations

  • Contextual Factors:

    • Examine species-specific variations that might explain functional differences

    • Consider developmental stages and environmental conditions during experiments

    • Evaluate potential post-translational modifications affecting function

  • Multifunctional Hypothesis Testing:

    • Investigate whether cemA may have multiple distinct functions

    • Test context-dependent activity under different conditions

    • Explore potential moonlighting functions in different cellular compartments

  • Integration of Evidence:

    • Weight evidence based on methodological robustness

    • Develop models that accommodate seemingly contradictory data

    • Design experiments specifically to test competing hypotheses

This approach recognizes that complex membrane proteins like cemA may have context-dependent functions or multiple roles that manifest differently depending on experimental conditions. Systematic evaluation of methodological differences is particularly important when interpreting results from different research groups.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.