Recombinant Oryza nivara Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
petD
Target Protein Sequence
MGVSKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGLF
Uniprot No.

Target Background

Function

Recombinant Oryza nivara Cytochrome b6-f complex subunit 4 (petD) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does the petD subunit play in photosynthesis?

The Cytochrome b6-f (Cyt b6f) complex is a crucial component of the photosynthetic electron transport chain, serving as an intermediate between photosystem II and photosystem I. It functions in plastoquinone oxidation at the Qp site and is considered one of the key steps in photosynthesis .

How does Oryza nivara differ from cultivated rice species in terms of genetic diversity and potential for crop improvement?

Oryza nivara is a wild rice species that serves as an important genetic resource for rice improvement. Studies have shown significant genetic diversity in O. nivara populations, with continuous variation in traits and high levels of admixture (59%) .

Population structure assessment using various methodologies (PCA, Structure, and AMOVA) has revealed unclear differentiation among O. nivara accessions, indicating substantial gene flow within wild populations and accumulated historical recombination events . This genetic diversity makes O. nivara valuable for identifying beneficial traits for cultivated rice improvement.

Research has demonstrated that interspecific hybrids between O. sativa and O. nivara can exhibit significant improvements in various traits, including:

  • Higher seed protein content (up to 28% higher than parents)

  • Improved plant height and panicle characteristics

  • Enhanced amino acid content, with hybrids showing net gains of 19.5% in lysine and 19.4% in threonine over the O. nivara parent

This genetic diversity and beneficial trait potential make O. nivara an excellent source for crop improvement programs.

What methods are most effective for expressing and purifying recombinant petD protein, and what expression systems yield the highest functional protein?

For successful expression and purification of recombinant petD protein, the following methodological approaches have proven effective:

Expression Systems:

  • E. coli-based expression: Using pET vector systems (such as pET-21d+) has shown effective overexpression of membrane proteins similar to petD . This approach enables quick production of significant quantities of recombinant proteins.

  • Alternative expression hosts: While E. coli is most common, expression in yeast, baculovirus, or mammalian cell systems may be considered for specific research needs .

Purification Protocol:

An effective protocol for obtaining active Cyt b6f complex involves:

  • Extraction and initial purification:

    • Suspend chloroplasts in buffer containing protease inhibitors (benzamidine, ε-aminocaproic acid, and PMSF at 1mM each)

    • Sonication using a 500-W ultrasonic processor with specific pulse parameters

    • Ultracentrifugation at approximately 148,000 g

  • Column chromatography:

    • Load supernatant onto a propyl-Sepharose column

    • Use stepwise elution with decreasing ammonium sulfate concentration

    • Concentrate using microconcentrators and perform buffer exchange

  • Final purification:

    • Sucrose gradient ultracentrifugation (10-25% continuous gradient)

    • Collection of the brownish band containing purified protein

The quality and activity of the purified protein should be verified through biochemical analysis, including enzymatic activity, optical spectroscopy, and electrophoretic analysis to confirm the presence of all subunits and enzymatic functionality .

How can researchers effectively verify the functional activity of recombinant petD protein in experimental systems?

Verification of recombinant petD protein functionality requires several complementary approaches:

Spectroscopic Analysis:

  • Optical spectroscopy: Measure absorbance spectra at room temperature before and after oxidation with potassium ferricyanide or reduction with sodium dithionite .

  • Electron Paramagnetic Resonance (EPR) spectroscopy: Record spectra at low temperature (approximately 10K) using appropriate parameters (microwave frequency ~9.4 GHz, microwave power ~6.35 mW) .

Activity Measurements:

Measure Cyt b6f-mediated reduction of plastocyanin (PC) using the following protocol:

  • Prepare oxidized PC using potassium ferricyanide (later removed by concentration-dilution)

  • Prepare reduced decylplastoquinone (dPQH2) using hydrogen gas with platinum on carbon catalyst

  • Combine PC, dPQH2, and purified protein in appropriate buffer

  • Monitor reaction progress spectrophotometrically and determine PC reduction rate from the initial slope

Typical turnover rates for functional Cyt b6f complex are approximately 120 per second under optimal conditions .

Western Blotting:

For detection and quantification of petD protein, modified western blotting protocols can be used:

  • Testing with different secondary antibodies (superclonal HRP, polyclonal HRP, poly HRP)

  • Quantifying band intensity using densitometry

  • Comparing signal between wild-type and engineered/recombinant proteins

What genomic and molecular techniques are most useful for studying mutations in the petD gene and their effects on photosynthetic electron transport?

Several molecular approaches are effective for investigating petD mutations:

GWAS and Candidate Gene Mining:

  • Utilize genome-wide association studies (GWAS) with high-quality SNPs

  • Implement multi-locus GWAS models (ML-GWAS) as demonstrated in similar studies

  • Use software tools like Structure v2.3.4, PGDSpider, GAPIT, and TASSEL v2.5 for comprehensive analysis

Mutation Analysis Methods:

  • Study point mutations specifically affecting the quinone-binding Qo site to understand electron transport mechanisms

  • Create mutations at critical residues in recombinant systems to mimic naturally occurring variants

  • Compare with wild-type using structure-function analysis

When examining mutations affecting the Cyt b6f complex, researchers should consider:

  • Complete loss-of-function mutations

  • Point mutations affecting specific functional sites (e.g., Qo site)

  • Effects on light induction of tetrapyrrole biosynthetic genes

Research indicates that defects in the Cyt b6f complex can abolish or strongly reduce light induction of chlorophyll biosynthesis genes, while defects in photosystem II, photosystem I, or plastocyanin do not show the same effects .

What protocols are recommended for measuring silica content in Oryza species when comparing wild and cultivated varieties?

When studying the relationship between Oryza nivara and cultivated rice varieties, researchers often analyze silica content as a differentiating trait. The following protocol has been validated for accurate silica measurement:

Sample Preparation:

  • Collect stem and leaf parts (excluding roots and panicles)

  • Chop samples into smaller pieces

  • Dry in hot air oven at 70°C for 7 days

  • Grind dried samples to fine powder and sift through mesh sieve

  • Further oven-dry at 60°C for 2 days

Silica Quantification:

Use the autoclave-based digestion-mediated molybdenum blue colorimetry method:

  • Use 0.1g of powdered sample for each genotype

  • Perform analysis in duplicate for statistical accuracy

  • Plot distribution of mean straw silica content as histogram

  • Perform Shapiro-Wilk test to check for normal distribution

This method has revealed significant variation in straw silica content between O. nivara accessions (ranging from 5.08% to 16%) and cultivated varieties (varying from 6.18% to 15.81%), making it valuable for comparative studies .

How can researchers effectively design experiments to identify and validate the role of petD in interspecific hybrids of Oryza species?

When investigating petD function in interspecific rice hybrids, consider the following experimental design approaches:

Hybrid Development and Confirmation:

  • Generate interspecific hybrids between O. sativa and O. nivara

  • Confirm hybridity through molecular markers and restriction fragment length polymorphism

  • Ensure no additional or novel restriction fragments are present

Protein Expression Analysis:

  • Perform SDS-PAGE analysis of total proteins

  • Identify specific polypeptide changes (particularly in the 13-14 kDa, 21-23 kDa, and 34-39 kDa ranges)

  • Use t-test to compare protein levels between lanes of parental lines

Ultrastructural Analysis:

Electron microscopy can reveal differences in protein bodies and cellular structures:

Structure TypeParental LinesHybrid
Protein Bodies Type I (PB-I)Normal distributionHigher preponderance
Protein Bodies Type II (PB-II)Normal morphologyAltered distribution
AmyloplastStandard structureMay show modifications
Endoplasmic reticulumNormalMay show increased activity

These techniques have successfully demonstrated that interspecific hybrids can show significant improvements in protein content and composition compared to their parents .

What approaches are most effective for analyzing the role of cytochrome b6f complex in response to environmental stresses like salinity?

To study how the Cyt b6f complex functions under salt stress conditions, researchers can implement the following methodological approaches:

Physiological Measurements:

  • Assess plant growth parameters under control and salt stress conditions:

    • Root and shoot length

    • Leaf surface area and development

    • Photosynthetic capacity

  • Analyze pigment content changes:

    • Chlorophyll a and b quantification

    • Carotenoid measurement

    • Determination of pigment ratios (Chl a/b, Chl/Carotenoids)

Protein Analysis Under Stress:

For analyzing photosynthetic complex proteins under salt stress:

  • Western blotting with antibodies against various components:

    • PsbO, PsbP, PsbQ, and PsbR proteins show differential responses to salt stress

    • Quantify protein levels by determining NaCl/Control protein ratios

  • Thylakoid membrane protein extraction and analysis:

    • SDS-PAGE separation

    • Identification of changes in protein abundance in regions below 20 kDa (where many photosynthetic complex components migrate)

Research has shown that salt treatment induces specific changes in photosynthetic complex proteins, with increases in PsbP and PsbQ proteins in wild rice (OR plants) (1.7 and 1.3-fold relative to control) and various changes in other rice genotypes .

What are common challenges in recombinant petD protein expression and how can researchers overcome them?

Researchers commonly encounter several challenges when working with recombinant petD protein:

Expression Challenges and Solutions:

ChallengeCauseSolution
Low expression levelsMembrane protein nature of petDUse stronger promoters or optimize codon usage
Protein misfoldingImproper folding environmentExpress at lower temperatures (16-20°C)
Inclusion body formationOverexpressionReduce expression rate or use solubility tags
Toxicity to host cellsDisruption of host membranesUse tightly controlled induction systems
Protein degradationHost proteasesInclude protease inhibitors (PMSF, benzamidine) throughout purification

Purification Optimization:

When purifying recombinant petD protein, the following strategies can improve yield and purity:

  • For E. coli-expressed protein:

    • Optimize lysis conditions (sonication parameters, buffer composition)

    • Consider specialized detergents for membrane protein extraction

    • Use affinity chromatography with appropriate tags determined during production

  • Storage considerations:

    • Store in Tris-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • For short-term storage, keep working aliquots at 4°C for up to one week

These approaches have been successfully applied to similar membrane proteins and can be adapted specifically for petD protein purification.

How can researchers address issues with functional reconstitution of recombinant petD into photosynthetic complexes?

Functional reconstitution of recombinant petD into complete Cyt b6f complexes presents several challenges:

Reconstitution Approaches:

  • In vitro assembly strategy:

    • Combine purified recombinant petD with other purified Cyt b6f components

    • Carefully control detergent concentration during reconstitution

    • Add essential cofactors (hemes, iron-sulfur clusters) during assembly

  • Lipid environment optimization:

    • Reconstitute in lipid environments mimicking thylakoid membranes

    • Use appropriate lipid-to-protein ratios

    • Consider nanodiscs or liposomes for membrane protein stabilization

Activity Verification After Reconstitution:

To verify successful reconstitution, researchers should:

  • Measure enzymatic activity:

    • Determine cytochrome b6f-mediated reduction of plastocyanin

    • Calculate turnover rates (functional complexes typically show rates of ~120 per second)

  • Perform spectroscopic analysis:

    • Confirm proper incorporation of cofactors through absorption spectra

    • Use EPR spectroscopy to verify structural integrity of iron-sulfur centers

These methodologies help ensure that reconstituted complexes maintain native-like properties and activities.

What considerations are important when comparing wild-type and mutated versions of petD for structure-function studies?

When conducting structure-function studies comparing wild-type and mutated petD proteins, researchers should consider:

Experimental Design Considerations:

  • Mutation selection strategy:

    • Focus on conserved residues identified through sequence alignment

    • Target known functional regions (e.g., quinone binding sites)

    • Consider naturally occurring mutations found in diverse Oryza species

  • Control experiments:

    • Include multiple controls (wild-type, known mutants with characterized phenotypes)

    • Use point mutations specifically affecting the Q₀ site to understand electron transport mechanisms

    • Compare with defects in other complexes (photosystem II, photosystem I, plastocyanin) to distinguish specific effects

Performance Assessment Methods:

Comparative analysis should include:

  • Protein expression and stability:

    • Western blot analysis with densitometry

    • Protein half-life determination

  • Functional assays:

    • Measure effects on electron transport

    • Assess impact on light induction of chlorophyll biosynthesis genes

    • Quantify turnover rates between wild-type and mutant proteins

  • Structural impacts:

    • Use computed structure models to predict effects of mutations

    • Consider pLDDT (predicted Local Distance Difference Test) confidence scores for different regions

Mutations affecting the cytochrome b6f complex can have distinct effects compared to mutations in other photosynthetic complexes, particularly on gene expression patterns related to chlorophyll biosynthesis .

How might genetic engineering of petD contribute to improved crop photosynthetic efficiency and stress tolerance?

The potential for petD genetic engineering to enhance crop performance includes several promising research directions:

Photosynthetic Efficiency Enhancement:

  • Engineering the quinone binding sites to:

    • Increase electron transport rates

    • Reduce reactive oxygen species production

    • Improve energy conservation during photosynthesis

  • Modifying regulatory regions to optimize expression:

    • Enhance response to varying light conditions

    • Improve coordination with other photosynthetic components

Stress Tolerance Improvement:

Oryza nivara naturally possesses mechanisms for environmental adaptation that could be harnessed through petD engineering:

  • Enhancing salt stress tolerance:

    • Current research shows variable responses of photosynthetic complexes to salt stress

    • Engineering stable complex assembly under stress conditions could improve performance

  • Improving temperature adaptation:

    • Modifying petD to maintain optimal function at temperature extremes

    • Engineering protein stability across diverse environmental conditions

These approaches leverage the natural variation found in wild Oryza species, which have evolved to survive in diverse habitats, potentially transferring these advantages to cultivated rice varieties.

What are the implications of interspecific hybridization involving Oryza nivara for understanding complex genetic traits and heterosis?

Interspecific hybridization between O. sativa and O. nivara offers valuable insights into genetic mechanisms:

Heterosis Mechanisms:

Research on O. sativa × O. nivara hybrids has revealed:

  • Significant increases in seed protein content (12.4%, which was 28% and 18.2% higher than O. nivara and IR 64 parents, respectively)

  • Enhanced amino acid profiles (19.5% increase in lysine, 19.4% increase in threonine)

  • Changes in protein body ultrastructure with higher preponderance of prolamin-containing PB-I

These improvements were not the result of chromosomal rearrangements or transposable element activation in the regions containing seed storage protein genes, suggesting complex regulatory mechanisms .

Genetic Architecture of Complex Traits:

The inheritance pattern of increased protein content in O. sativa × O. nivara hybrids appears polygenic in nature, offering opportunities to:

  • Identify quantitative trait loci (QTLs) associated with protein content

  • Develop marker-assisted selection strategies

  • Understand regulatory networks controlling storage protein accumulation

Such interspecific hybrid studies provide a foundation for developing superior rice cultivars combining high yield, improved nutritional quality, and enhanced stress tolerance.

How could advances in cryo-EM and structural biology enhance our understanding of recombinant petD within the cytochrome b6f complex?

Recent advances in structural biology offer new opportunities for petD research:

Cryo-EM Structural Insights:

High-resolution cryo-EM studies of the cytochrome b6f complex have revealed:

  • The arrangement of plastoquinones lining up head to tail near the Qp site

  • Evidence for a quinone channel in each monomer

  • Support for a "one-way traffic model" explaining efficient quinol oxidation

These structural insights can guide targeted engineering of recombinant petD protein to enhance function or stability.

Molecular Dynamics and Computational Approaches:

Integration of structural data with computational methods allows:

  • Simulation of electron transport dynamics

  • Prediction of mutation effects on structure and function

  • Identification of critical residues for engineering enhanced properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.