Recombinant Oryza nivara Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For multiple uses, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex plays a vital role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the cytochrome b6/f complex function in photosynthesis?

The cytochrome b6/f complex serves as an electronic junction between photosystem II and photosystem I in the photosynthetic electron transport chain. Its primary functions include:

  • Oxidizing plastoquinol and reducing plastocyanin, thereby facilitating electron transport

  • Contributing to the generation of a proton gradient across the thylakoid membrane

  • Participating in state transitions that balance excitation energy between photosystems

  • Acting as a redox sensor that initiates signaling processes in response to changes in light conditions

The complex exists primarily as a dimer in vivo, although monomeric and intermediate forms are also observed . In the dac mutant described in search result , researchers observed a lower ratio of dimer to monomer and an increase in intermediate forms, suggesting the importance of proper assembly for optimal function.

How is recombinant Oryza nivara cytochrome b6 typically produced?

Recombinant Oryza nivara cytochrome b6 can be produced through heterologous expression systems. While the search results do not provide specific production methods for this exact protein, general approaches typically involve:

  • Gene synthesis or PCR amplification of the petB coding sequence

  • Cloning into an appropriate expression vector

  • Transformation into a suitable expression host (bacterial, yeast, or insect cell systems)

  • Induction of protein expression

  • Purification using affinity chromatography (facilitated by fusion tags)

The recombinant protein described in search result is available as a 50 μg preparation in a Tris-based buffer with 50% glycerol, optimized for stability. Storage recommendations include keeping the protein at -20°C for regular storage or -80°C for extended storage periods, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What role does the C-terminus of cytochrome b6 play in complex assembly and function?

The C-terminus of cytochrome b6 (PetB) plays a critical role in both the assembly of the cytochrome b6/f complex and its functional activities. Research using site-directed mutagenesis of the chloroplast petB gene in Chlamydomonas reinhardtii has revealed several important aspects:

  • Truncation (removal of L215b6) or elongation (addition of G216b6) of the cytochrome b6 C-terminus leads to the loss of heme ci and subsequent degradation by FTSH protease

  • Salt bridge formation between cytochrome b6 (PetB) and Subunit IV (PetD) is essential for the stable assembly of the complex

  • The C-terminus is involved in the phosphorylation cascade that regulates state transitions

When researchers modified the C-terminus in double mutants where FTSH was inactivated, the modified cytochrome b6/f complexes accumulated but showed a blocked phosphorylation cascade. Additionally, replacement of the arginine (R207Kb6) that interacts with heme ci propionate resulted in slower phosphorylation kinetics, despite the presence of heme ci .

How do mutations in cytochrome b6 affect photosynthetic state transitions?

State transitions represent a regulatory mechanism that optimizes photosynthetic efficiency by redistributing light energy between Photosystem I and Photosystem II. Research indicates that cytochrome b6 plays a crucial role in this process:

  • The cytochrome b6/f complex activates the STT7 protein kinase following reduction of the plastoquinone pool

  • Modifications to the C-terminus of cytochrome b6 affect the phosphorylation of STT7 and subsequent state transitions

  • Highly phosphorylated forms of STT7 accumulate transiently after plastoquinone pool reduction and represent the active forms of the protein kinase

  • The phosphorylation of Light Harvesting Complex II (LHCII) targets occurs preferentially over the protein kinase itself

  • The migration of LHCII toward Photosystem I represents the rate-limiting step in state transitions

These findings suggest that research on recombinant Oryza nivara cytochrome b6 should consider how structural modifications might affect not only protein stability but also its regulatory functions in photosynthesis.

What techniques are most effective for studying cytochrome b6/f complex assembly?

Several complementary techniques have proven valuable for investigating the assembly and stability of the cytochrome b6/f complex:

  • Blue Native PAGE (BN-PAGE): This technique allows visualization of the complex in its native state, differentiating between dimeric, monomeric, and intermediate forms. In studies of the dac mutant, longer exposure times were required to detect bands, indicating decreased subunit accumulation .

  • Immunoblotting: Using antibodies against specific subunits (Cyt f, Cyt b6, PetD), researchers can track protein levels during assembly or degradation processes. This approach revealed similar degradation rates of assembled subunits in both wild-type and dac mutant plants but showed very short half-lives for newly synthesized proteins in the mutant .

  • Protein Synthesis Inhibition Studies: Treatment with lincomycin (an inhibitor of chloroplast protein synthesis) allows researchers to study the degradation rates of existing complexes independent of new protein synthesis .

  • Site-Directed Mutagenesis: This approach enables precise modification of specific amino acids to study their roles in complex assembly and function, as demonstrated in studies of the C-terminus of cytochrome b6 .

How does Oryza nivara cytochrome b6 compare to orthologs in other species?

While the search results do not provide a direct comparison of cytochrome b6 sequences across species, genetic and evolutionary studies of Oryza nivara offer context for understanding potential adaptations:

Oryza nivara evolved from a perennial ancestor resembling its sister species Oryza rufipogon, associated with an ecological shift from persistently wet to seasonally dry habitats . This adaptation involved changes in life history, mating system, and flowering time. Quantitative trait locus (QTL) analysis revealed that more than 80% of QTL alleles of O. nivara acted in the same direction of phenotypic evolution, suggesting fixation under directional selection .

The genome of O. nivara has been sequenced as part of efforts by organizations like NBRP-RICE to provide genetic resources for research . Genome-wide association studies have been conducted to understand various traits in O. nivara accessions, using techniques such as genotyping by sequencing (GBS) with the ddRADseq approach .

What are the optimal conditions for storing and handling recombinant Oryza nivara cytochrome b6?

Based on the product information available for recombinant Oryza nivara cytochrome b6:

Storage ConditionRecommendationPurpose
Long-term storage-20°C or -80°CMaintain protein stability
Working aliquots4°CFor use within one week
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Handling precautionAvoid repeated freeze-thaw cyclesPrevent protein denaturation

The storage buffer is specially optimized for this particular protein to maintain its native conformation and activity . When designing experiments using recombinant cytochrome b6, researchers should consider its hydrophobic nature as a membrane protein and may need to include appropriate detergents or lipid environments to maintain its structure and function.

How can researchers study the interaction between cytochrome b6 and other components of the photosynthetic apparatus?

Several approaches can be employed to study interactions involving cytochrome b6:

  • Co-immunoprecipitation: Using antibodies against cytochrome b6 or potential interaction partners to pull down protein complexes

  • Crosslinking studies: Employing chemical crosslinkers to stabilize transient protein-protein interactions

  • Yeast two-hybrid or split-ubiquitin systems: For detecting binary protein interactions

  • Blue Native PAGE: For analyzing intact protein complexes

  • Fluorescence resonance energy transfer (FRET): To study protein interactions in vivo

Research on the cytochrome b6/f complex has revealed that salt bridge formation between cytochrome b6 (PetB) and Subunit IV (PetD) is essential for complex assembly . Studies in Chlamydomonas reinhardtii have also shown that the C-terminus of cytochrome b6 interacts with the STT7 kinase during state transitions, making this region a potential focus for interaction studies .

What genetic approaches can be used to study cytochrome b6 function in Oryza nivara?

Genetic approaches for studying cytochrome b6 function may include:

  • CRISPR/Cas9 genome editing: For creating specific mutations in the petB gene

  • Complementation studies: Using wild-type petB to rescue mutant phenotypes

  • Site-directed mutagenesis: To study the effects of specific amino acid changes

  • Heterologous expression: Expressing O. nivara petB in model systems like E. coli or yeast

  • Quantitative trait locus (QTL) analysis: To associate natural variation in photosynthetic traits with genetic loci

The NBRP-RICE resource provides access to wild Oryza accessions, including O. nivara, which can be valuable for genetic studies . Genome-wide association studies have been conducted on O. nivara accessions, demonstrating the feasibility of genetic approaches in this species .

What are the main challenges in studying Oryza nivara cytochrome b6?

Researchers face several challenges when studying Oryza nivara cytochrome b6:

  • Membrane protein expression: As a membrane protein, cytochrome b6 can be difficult to express and purify in a functional form

  • Complex assembly: The protein functions as part of a multi-subunit complex, requiring appropriate conditions for assembly

  • Functional assays: Developing assays that accurately measure electron transport activity

  • Species-specific considerations: Adapting protocols developed for model organisms to work with O. nivara

  • Access to genetic resources: Although resources like NBRP-RICE provide access to wild Oryza accessions, obtaining specific genetic variants may be challenging

How might research on Oryza nivara cytochrome b6 contribute to crop improvement?

Research on photosynthetic components like cytochrome b6 has several potential applications in crop improvement:

  • Enhanced photosynthetic efficiency: Understanding the regulation of electron transport could lead to crops with improved carbon fixation

  • Stress tolerance: The cytochrome b6/f complex plays a role in responses to environmental changes, making it relevant to developing stress-resistant crops

  • Genetic diversity: Wild species like O. nivara represent valuable genetic resources for rice improvement programs

  • Evolutionary insights: Comparative studies between wild and cultivated species can reveal adaptations associated with domestication and environmental challenges

The evolution of O. nivara from a perennial ancestor involved adaptation to seasonally dry habitats, suggesting that this species may harbor useful traits for improving drought tolerance in cultivated rice .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.