Recombinant Oryza nivara NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIIASLIPILAFWISALLAPVREGPEKLSSYESGIEPMGGAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGISVFIEAFIFVLILVVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially the chloroplast respiratory chain. In this organism, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Oryza nivara NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)?

Recombinant Oryza nivara NAD(P)H-quinone oxidoreductase subunit 3 is a protein component of the chloroplastic NAD(P)H dehydrogenase complex (NDH) in wild rice species. The protein is encoded by the chloroplast genome and expressed recombinantly for research purposes. As part of the NDH complex, ndhC contributes to cyclic electron transport around photosystem I, chlororespiration, and stress adaptation mechanisms in plants. The recombinant form allows researchers to study its structure, function, and interactions outside the complexity of the whole plant system .

How does ndhC function within the NAD(P)H-quinone oxidoreductase complex?

The ndhC subunit works as an integral component of the chloroplastic NDH complex, likely participating in the electron transfer pathway from NAD(P)H to plastoquinone. Based on studies of similar oxidoreductases, we can infer that ndhC may contribute to the formation of the quinone binding pocket and facilitate the two-electron reduction of quinones to hydroquinones . This mechanism helps prevent the formation of semiquinone radicals that could generate reactive oxygen species. The complex participates in cyclic electron flow, which is crucial for balancing the ATP/NADPH ratio required for carbon fixation and other chloroplast processes. Understanding how ndhC contributes to these activities requires consideration of its interactions with other subunits and the structural elements that enable electron transfer.

What are the key structural features predicted for ndhC?

While the specific structure of Oryza nivara ndhC has not been fully determined, comparative analysis with related proteins suggests several key features:

  • Transmembrane domains: As a chloroplastic membrane protein, ndhC likely contains multiple membrane-spanning helical regions anchoring it in the thylakoid membrane.

  • Quinone-binding motifs: Similar to other NAD(P)H-quinone oxidoreductases, specific residues likely contribute to quinone binding, potentially including aromatic amino acids (Tyr, Phe, Trp) that create a hydrophobic pocket and residues capable of hydrogen bonding with quinone oxygens .

  • Subunit interface regions: Domains that mediate interactions with other components of the NDH complex.

  • Conserved sequence motifs: Regions with high sequence conservation across species likely indicate functionally critical domains involved in catalysis or complex assembly.

What expression systems are optimal for producing functional recombinant ndhC?

The choice of expression system significantly impacts the yield and functionality of recombinant ndhC. Based on available product information and research approaches for similar proteins, the following systems have distinct advantages:

Expression SystemAdvantagesLimitationsOptimization Strategies
Yeast (P. pastoris, S. cerevisiae)Post-translational modifications, membrane protein folding capability, moderate yieldLonger production time than bacteriaCodon optimization, inducible promoters, fusion tags
E. coliRapid growth, cost-effective, well-established protocolsMay form inclusion bodies, lacks post-translational modificationsLow temperature induction, specialized strains (C41/C43), fusion partners
Insect cellsSuperior for complex membrane proteinsHigher cost, specialized equipment neededOptimize MOI, harvest timing, expression screening
Cell-free systemsAvoids toxicity issues, rapidLower yield, higher costSupplement with lipids/detergents, optimize reaction components

For chloroplastic membrane proteins like ndhC, yeast systems often provide the best compromise between proper folding and reasonable yield . Codon optimization for the chosen expression host is essential, as is the inclusion of affinity tags (His, GST) to facilitate purification while minimizing interference with function.

What purification strategy ensures optimal recovery of functional ndhC?

A multi-step purification approach is recommended to obtain functional ndhC protein:

  • Membrane extraction: Carefully solubilize membranes using mild detergents (DDM, LMNG) that maintain native protein conformation. Screen multiple detergents at various concentrations to identify optimal conditions.

  • Affinity chromatography: Utilize His-tag or other fusion tags for initial capture. Include detergent at concentrations above CMC throughout purification to prevent aggregation.

  • Size exclusion chromatography: Remove aggregates and verify proper oligomeric state. Monitor UV absorbance to assess protein quality and homogeneity.

  • Ion exchange chromatography: Further purify based on charge properties if needed.

Throughout purification, maintain reducing conditions (DTT or β-mercaptoethanol) to protect thiol groups and consider including stabilizers like glycerol. Test activity at each purification stage to track recovery of functional protein. For research requiring highly pure preparations, analytical techniques such as SDS-PAGE, Western blotting, and mass spectrometry should be employed to verify purity and identity .

How can I verify the functional integrity of purified recombinant ndhC?

Verifying functional integrity requires multiple complementary approaches:

  • Activity assays: Measure quinone reduction activity spectrophotometrically by monitoring NAD(P)H oxidation at 340 nm. Compare activity with structurally characterized NAD(P)H-quinone oxidoreductases using substrates like duroquinone . Calculate kinetic parameters (Km, Vmax) and compare with expected values.

  • Structural assessment: Use circular dichroism spectroscopy to confirm secondary structure elements and thermal shift assays to evaluate protein stability. Size exclusion chromatography can verify proper oligomeric state.

  • Binding studies: Assess substrate interaction using techniques like isothermal titration calorimetry or fluorescence-based binding assays. This can provide information about binding affinity and stoichiometry even if full enzyme activity cannot be reconstituted.

  • Reconstitution assays: For definitive functional verification, demonstrate the ability of purified ndhC to reconstitute electron transfer activity when combined with other subunits of the NDH complex.

How can I investigate the substrate specificity of ndhC?

Investigating substrate specificity of ndhC requires a systematic approach combining biochemical and structural methods:

  • Substrate screening: Test activity with a panel of structurally diverse quinones varying in ring structure, substituent groups, and redox potential. Analyze the kinetic parameters for each substrate using steady-state kinetics.

SubstrateStructureKm (μM)kcat (s-1)kcat/Km (M-1s-1)Relative Efficiency (%)
Duroquinone2,3,5,6-tetramethyl-p-benzoquinonexyz100
PlastoquinoneNatural chloroplast electron acceptorxyz%
Other quinonesVarious structuresxyz%
  • Structure-activity relationship analysis: Correlate chemical features of substrates with their kinetic parameters to identify determinants of specificity.

  • Binding mode characterization: For substrates that show significant activity, investigate their binding mode through:

    • Computational docking studies

    • Mutagenesis of predicted binding site residues

    • Structural studies (if possible) of enzyme-substrate complexes

Draw insights from structural studies of related enzymes like human NAD(P)H:quinone oxidoreductase (QR1), which show specific substrate binding characteristics and electron transfer mechanisms. In human QR1, for example, one carbon of the quinone ring positions closer to the flavin N5, suggesting direct hydride transfer to this atom .

What approaches are most effective for analyzing protein-protein interactions involving ndhC?

As a component of a multi-subunit complex, ndhC's interactions with other proteins are crucial to its function. Several complementary approaches are effective for characterizing these interactions:

  • Co-immunoprecipitation: Use antibodies against ndhC or tagged versions to pull down interacting partners from chloroplast extracts. Analyze by mass spectrometry to identify proteins that co-precipitate.

  • Crosslinking coupled with mass spectrometry: Apply crosslinking agents to stabilize transient interactions, then identify crosslinked peptides by mass spectrometry to map interaction interfaces.

  • Yeast two-hybrid or split-protein complementation: Test specific hypothesized interactions, especially for soluble domains of ndhC.

  • Surface plasmon resonance or biolayer interferometry: Quantitatively measure binding kinetics and affinities between ndhC and potential interacting partners.

  • Reconstitution studies: Systematically combine purified components to determine the minimal set required for activity and the impact of each subunit on enzyme properties.

  • Cryo-electron microscopy: For structural characterization of the entire complex, potentially revealing the precise position and interactions of ndhC within the assembly.

When designing these experiments, consider controls for specificity, such as mutation of predicted interaction surfaces or competition with excess untagged protein. The dynamic nature of these interactions may require stabilization strategies or studying the complex under various physiological conditions.

How can I investigate the role of specific residues in ndhC function?

Structure-function analysis through site-directed mutagenesis provides powerful insights into the mechanistic roles of specific residues:

  • Residue identification: Select targets based on:

    • Sequence conservation across species

    • Homology to residues with known functions in related proteins

    • Predicted involvement in substrate binding, catalysis, or protein-protein interactions

    • Computational modeling or structural information

  • Mutagenesis strategy: Design mutations that test specific hypotheses:

    • Conservative substitutions to test chemical requirements (e.g., Tyr→Phe to test importance of hydroxyl group)

    • Charge reversals to test electrostatic interactions

    • Alanine scanning to identify essential residues

  • Functional assessment: Compare wild-type and mutant proteins for:

    • Enzyme kinetics (Km, kcat, substrate specificity)

    • Protein stability and folding

    • Complex assembly capability

    • In vivo function through complementation studies

Drawing parallels from human QR1 studies, residues like Tyr-128 and His-161 might be particularly important, as they participate in substrate binding and catalysis in this related enzyme . Position-specific effects observed in human QR1, such as the closure of the binding site by Tyr-128 and loop residues 232-236 after substrate binding, may have functional counterparts in ndhC .

How does Oryza nivara ndhC compare with homologs in other plant species?

Comparative analysis of ndhC across plant species provides insights into both conserved functional elements and species-specific adaptations:

  • Sequence conservation analysis:

    • Core functional domains typically show high conservation

    • Variable regions may reflect adaptation to specific ecological niches

    • Alignment of ndhC sequences from diverse plants can identify signature residues for different taxonomic groups

  • Structural comparison:

    • Homology modeling based on available structures

    • Analysis of predicted transmembrane topology across species

    • Identification of conserved vs. variable surface regions that may mediate species-specific interactions

  • Functional divergence:

    • Comparison of enzymatic properties when expressed in the same system

    • Ability to complement mutants across species boundaries

    • Differences in regulation or post-translational modifications

  • Evolutionary analysis:

    • Phylogenetic reconstruction to understand evolutionary relationships

    • Analysis of selection pressures on different protein regions

    • Correlation with the evolution of photosynthetic mechanisms

Such comparative studies can reveal how ndhC has adapted to different environmental conditions while maintaining its core function in the chloroplast electron transport chain.

What functional differences exist between plant ndhC and mammalian NAD(P)H:quinone oxidoreductases?

While both plant ndhC and mammalian NAD(P)H:quinone oxidoreductases catalyze quinone reduction, they exhibit significant differences reflecting their distinct evolutionary origins and cellular roles:

FeaturePlant ndhCMammalian NAD(P)H:quinone oxidoreductase (QR1)
Cellular locationChloroplast thylakoid membranePrimarily cytosolic
Complex organizationSubunit of large NDH complexFunctions as homodimer
Electron donorLikely ferredoxin or NADPHNADH and NADPH
Preferred substratesPlastoquinone and related moleculesVarious quinones and other electrophiles
Catalytic mechanismComponent of multi-step electron transferDirect hydride transfer in ping-pong mechanism
Physiological roleCyclic electron flow, chlororespirationDetoxification, antioxidant defense
RegulationIntegrated with photosynthetic controlInducible by electrophiles and oxidative stress

The mammalian enzyme has been extensively characterized structurally, revealing specific features like a characteristic binding site that accommodates both NAD(P)H and quinone substrates sequentially . This detailed understanding provides a valuable reference point for investigating the distinct mechanisms of plant ndhC, while recognizing the fundamental differences in their biological contexts.

How can ndhC be utilized to study cyclic electron flow in photosynthesis?

Cyclic electron flow (CEF) is crucial for balancing the ATP/NADPH ratio in photosynthesis, and ndhC offers several experimental avenues to investigate this process:

  • Genetic approaches:

    • Create plants with modified ndhC expression (knockouts, knockdowns, point mutations)

    • Measure effects on photosynthetic parameters using chlorophyll fluorescence techniques

    • Complement mutants with wildtype or modified versions to establish structure-function relationships

  • Biochemical approaches:

    • Reconstitute minimal CEF systems in vitro using purified components

    • Measure electron transfer rates with various substrates and under different conditions

    • Investigate the regulation of activity by factors like NADPH/NADP+ ratio, pH, and redox state

  • Biophysical measurements:

    • Use spectroscopic methods to track electron flow through the NDH complex

    • Measure proton gradient formation associated with NDH activity

    • Correlate electron transport rates with ATP synthesis

  • Environmental response studies:

    • Compare NDH-dependent CEF under various stress conditions

    • Determine how ndhC contributes to photosynthetic efficiency under fluctuating light

    • Investigate the coordination between NDH-dependent and PGR5-dependent CEF pathways

Through these approaches, researchers can elucidate how ndhC contributes to maintaining photosynthetic efficiency under varying environmental conditions and energy demands.

What role does ndhC play in plant stress responses?

The NDH complex, including ndhC, has been implicated in plant responses to various environmental stresses:

  • High light stress:

    • NDH-mediated CEF may help dissipate excess excitation energy

    • This prevents over-reduction of the electron transport chain and photodamage

    • ndhC function can be assessed through chlorophyll fluorescence parameters under high light conditions

  • Drought and temperature stress:

    • The NDH complex may help maintain photosynthetic efficiency under restricted CO2 availability

    • It potentially contributes to thermal tolerance through regulation of electron flow

    • Comparative studies of wildtype and ndhC-modified plants under controlled stress conditions can reveal specific contributions

  • Oxidative stress management:

    • NDH activity may help prevent formation of reactive oxygen species

    • This could occur through maintaining proper redox balance in the chloroplast

    • Similar to mammalian quinone oxidoreductases, plant NDH may help prevent semiquinone radical formation

  • Experimental approaches to study these roles:

    • Transcriptomic analysis to correlate ndhC expression with stress responses

    • Physiological measurements comparing wildtype and mutant plants under stress

    • Biochemical assessment of NDH activity under in vitro conditions mimicking stress

Understanding these roles has implications for improving crop resilience to environmental challenges and may provide targets for enhancing stress tolerance through genetic engineering.

What are common challenges in expressing and purifying functional ndhC?

Researchers working with ndhC often encounter several technical challenges:

  • Expression yield issues:

    • As a membrane protein, ndhC may express poorly in heterologous systems

    • Solution: Optimize codon usage, test different fusion tags (His, MBP, SUMO), use specialized expression strains, and adjust induction conditions (temperature, inducer concentration, time)

  • Protein solubility and stability:

    • Tendency to aggregate or form inclusion bodies

    • Solution: Screen multiple detergents for membrane extraction, include stabilizers (glycerol, specific lipids), maintain reducing environment, and consider nanodiscs or other membrane mimetics

  • Functional reconstitution:

    • Difficulty in obtaining enzymatically active protein

    • Solution: Co-express with partner subunits, add necessary cofactors, reconstitute in liposomes with appropriate lipid composition, and consider the need for additional factors

  • Experimental assessment challenges:

    • Establishing reliable activity assays

    • Solution: Test multiple electron donors/acceptors, optimize assay conditions (pH, ionic strength, temperature), and develop sensitive detection methods for hydroquinone formation

Each challenge may require systematic troubleshooting to identify optimal conditions for the specific research application. Researchers should document detailed protocols for successful approaches to build on established methodologies.

What controls are essential when studying ndhC function?

  • Enzymatic activity assays:

    • Negative controls: Heat-inactivated enzyme, no-enzyme reactions, no-substrate controls

    • Positive controls: Related enzymes with known activity, commercially available oxidoreductases

    • Specificity controls: Substrate analogs, specific inhibitors, point mutations in catalytic residues

  • Genetic studies:

    • Background controls: Wild-type plants, empty vector transformants

    • Complementation controls: Rescue with wild-type gene to confirm phenotype causality

    • Specificity controls: Multiple independent transgenic lines, tissue-specific promoters

  • Structural studies:

    • Sample validation: Activity measurements of the preparation used for structural studies

    • Ligand-binding confirmation: Independent verification of substrate binding

    • Comparative controls: Structures with various ligands or under different conditions

  • Interaction studies:

    • Negative controls: Unrelated proteins, GST/His-tag alone

    • Competition controls: Excess untagged protein to verify specificity

    • Reciprocal pulldowns: Tag on different partners to confirm interactions

Implementing these controls ensures that experimental observations can be confidently attributed to specific ndhC functions rather than artifacts or general effects.

How can I optimize enzyme activity assays for ndhC?

Developing robust activity assays for ndhC requires systematic optimization:

  • Assay principle selection:

    • Spectrophotometric monitoring of NAD(P)H oxidation at 340 nm

    • Direct measurement of quinone reduction by absorbance changes

    • HPLC-based quantification of substrate conversion

    • Oxygen consumption measurements for coupled reactions

  • Parameter optimization:

    ParameterTest RangeConsiderations
    pH6.0-9.0Try various buffers (Tris, HEPES, phosphate)
    Temperature20-40°CBalance activity with stability
    Ionic strength50-300 mMMay affect protein-substrate interactions
    DetergentVarious types and concentrationsCritical for membrane protein activity
    Substrate concentration1-100 μMDetermine Km values to select appropriate ranges
  • Assay validation:

    • Verify linearity with respect to time and enzyme concentration

    • Confirm reproducibility across multiple protein preparations

    • Establish Z-factor for high-throughput applications

    • Verify correlation between activity and protein concentration

  • Troubleshooting strategies:

    • For low activity: Try different electron donors/acceptors, check protein quality, add potential cofactors

    • For high background: Include appropriate blanks, purify protein further, minimize non-enzymatic reactions

    • For poor reproducibility: Standardize protein preparation, control reaction conditions tightly, use internal standards

Optimized assay protocols should be thoroughly documented to ensure reproducibility and facilitate comparison between different studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.