Recombinant Oryza nivara NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

What is Oryza nivara and why is it significant in research?

Oryza nivara is a wild rice species native to India that belongs to the AA genome group. It is considered one of the progenitors of cultivated rice (Oryza sativa L.) and represents an important genetic resource for rice improvement programs . The species is primarily found in swampy areas, edges of ponds and tanks, beside streams, in ditches, and around rice fields, typically growing in shallow water up to 0.3 m deep in seasonally dry, open habitats .

Breeders and researchers are particularly interested in Oryza nivara because it exhibits resistance to grassy stunt virus, which can be transferred to cultivated varieties to enhance their disease resistance . It possesses 12 chromosomes and a nuclear genome size of approximately 448 Mb (determined by flow cytometry) .

What is NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) and what is its function?

NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a protein encoded by the ndhE gene in Oryza nivara. This protein functions as a component of the NAD(P)H dehydrogenase complex in chloroplasts (EC 1.6.5.-) . The complex is involved in chloroplast electron transport and contributes to cyclic electron flow around photosystem I, which is particularly important for optimizing photosynthesis under changing light conditions .

The protein has the following specifications:

• UniProt accession number: Q6ENA5

• Amino acid sequence: MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGDIFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN

• Alternative names: NAD(P)H dehydrogenase subunit 4L, NADH-plastoquinone oxidoreductase subunit 4L

How does Oryza nivara differ from Oryza rufipogon and cultivated rice?

The table below summarizes key differences between Oryza nivara, Oryza rufipogon, and cultivated rice (Oryza sativa):

The distinction between O. nivara and O. rufipogon has been debated, with some researchers considering O. nivara as a distinct species , while others view it as an ecotype of O. rufipogon. Recent molecular studies using SSRs, SNPs, and combined sequence data suggest sufficient differentiation to support species status for O. nivara .

What are the optimal conditions for expression of recombinant ndhE from Oryza nivara?

For optimal expression of recombinant ndhE from Oryza nivara, a Design of Experiments (DoE) approach is recommended over traditional one-factor-at-a-time optimization methods. DoE allows for the evaluation of multiple variables simultaneously, providing insights into factor interactions while requiring fewer experiments .

Based on research with other recombinant proteins, the following factors should be considered when designing an experiment for ndhE expression:

• Expression system selection: While Escherichia coli is commonly used due to its rapid growth, well-established genetic background, and available cloning vectors , alternative expression systems may be considered depending on the research goals.

• Key variables to optimize:

  • Induction temperature

  • Inducer concentration

  • Cell density at induction

  • Post-induction incubation time

  • Media composition (carbon source, nitrogen source)

  • pH

  • Aeration conditions

• Typical fractional factorial design: A 2^(8-4) design with 24 experimental conditions and central point replicates can efficiently identify significant variables affecting soluble expression .

• Response variables to measure:

  • Cell growth

  • Protein activity

  • Productivity of the recombinant protein

In one study with a different recombinant protein, this approach yielded high levels (250 mg/L) of soluble, functional protein with 75% homogeneity , demonstrating the potential efficacy of this methodology.

What purification strategies are most effective for isolating recombinant ndhE protein?

Purification of recombinant ndhE protein typically follows these steps:

• Cell lysis: Mechanical disruption (sonication, French press) or chemical methods (detergents, enzymatic lysis) depending on the expression system.

• Initial clarification: Centrifugation to separate soluble proteins from cell debris.

• Chromatographic techniques:

  • Affinity chromatography if the protein is expressed with a tag (His-tag, GST-tag)

  • Ion exchange chromatography based on the protein's isoelectric point

  • Size exclusion chromatography for final polishing

• Quality control assessment:

  • SDS-PAGE for purity evaluation

  • Western blotting for identity confirmation

  • Activity assays for functional validation

For recombinant ndhE specifically, the purification scheme should consider the protein's membrane-associated nature in its native form. Detergent screening may be necessary to maintain protein solubility and activity throughout the purification process.

How can experimental design approaches improve recombinant ndhE production?

A multivariant experimental design approach can significantly improve recombinant ndhE production by:

• Identifying statistically significant variables: Using factorial designs to determine which variables most strongly impact protein expression and solubility .

• Optimizing multiple parameters simultaneously: This allows for the detection of interaction effects between variables that might be missed in traditional optimization approaches .

• Reducing experimental time and resources: Fractional factorial designs require fewer experiments while still yielding valuable information about optimal conditions .

• Example of experimental design structure:

  • Select 6-8 key variables affecting protein expression

  • Create a fractional factorial design (e.g., 2^(8-4))

  • Include center point replicates to estimate experimental error

  • Analyze results using statistical software to identify significant factors and optimal conditions

Using this approach, researchers reported increasing soluble expression of a different recombinant protein from negligible amounts to 250 mg/L, with 75% homogeneity and retention of biological activity . This methodology enables robust process development with fewer experimental runs compared to traditional optimization approaches.

How can researchers analyze the functional activity of recombinant ndhE?

Functional analysis of recombinant ndhE can be conducted through several complementary approaches:

• Enzyme activity assays:

  • Spectrophotometric measurement of NAD(P)H oxidation

  • Monitoring electron transfer to various quinone acceptors

  • Assessing the rate of reaction under different substrate concentrations

• Integration into model membrane systems:

  • Reconstitution in liposomes to assess membrane association

  • Analysis of electron transport chain activity in artificial membrane systems

• Structural biology approaches:

  • Circular dichroism to evaluate secondary structure

  • Fluorescence spectroscopy for tertiary structure analysis

  • Crystallography or cryo-EM for detailed structural information (as part of a complex)

• Interaction studies:

  • Pull-down assays to identify binding partners

  • Yeast two-hybrid or bimolecular fluorescence complementation to verify protein-protein interactions

  • Blue native PAGE to analyze complex formation

Each method provides different insights into protein function, and a combination of approaches is typically necessary for comprehensive characterization of enzyme activity.

What are the challenges in differentiating wild and cultivated alleles in Oryza species crossing experiments?

Differentiating wild and cultivated alleles in Oryza species crossing experiments presents several challenges:

• Allele effect variations across genetic backgrounds: Wild allele effects can differ dramatically depending on whether they are expressed in wild or cultivated genetic backgrounds . For example, in a study of reciprocal backcross recombinant inbred lines (BRILs) between O. rufipogon and cultivated rice varieties, QTLs for seed shattering and seed awning showed strong wild allele effects only in cultivated backgrounds, not in wild backgrounds .

• Trait complexity and multigenic inheritance: Many important agricultural traits are controlled by multiple genes with complex inheritance patterns. For instance, the evolution of annual from perennial life form has a complex genetic basis that cannot be attributed to a single locus .

• Variable gene expression across environments: The expression of introduced alleles may vary depending on environmental conditions, making consistent phenotypic evaluation challenging.

• Direction of crossing effects: The same allele may produce different effects depending on whether it moves from wild to cultivated or cultivated to wild backgrounds . For example, research showed that cultivated loss-of-function alleles at seed shattering loci did not cause non-shattering phenotypes when introduced into wild rice .

• Genetic linkage and pleiotropy: Wild alleles may have pleiotropic effects on multiple traits, making it difficult to isolate the effect on a single trait of interest.

These challenges highlight the importance of developing appropriate genetic materials, such as introgression lines (ILs) and near-isogenic lines (NILs), to properly evaluate allele effects across different genetic backgrounds.

What NIH guidelines apply to research involving recombinant Oryza nivara proteins?

Research involving recombinant Oryza nivara proteins, including ndhE, must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Based on the search results and standard protocols, the following guidelines apply:

• Registration and approval requirements:

  • Most basic recombinant DNA experiments with plant proteins like ndhE would fall under Section III-E or III-F of the NIH Guidelines .

  • Experiments that are exempt under Section III-F include those involving DNA segments from a single nonchromosomal or viral DNA source, or entirely from a eukaryotic host when propagated only in that host or a closely related strain of the same species .

• Non-exempt experiments that require registration:

  • Deliberate transfer of a drug resistance trait to microorganisms that could compromise disease control

  • Cloning DNA encoding molecules lethal to vertebrates at an LD50 of < 100 μg/kg body weight

  • Large-scale DNA work (> 10 liters of culture)

• Special considerations for plant genes:

  • When cloning plant genes like ndhE into standard laboratory organisms (E. coli K-12, etc.), these experiments typically require only Institutional Biosafety Committee (IBC) notification before initiation .

  • The biosafety level is usually BSL-1 for non-pathogenic plant proteins .

Researchers must consult with their institutional biosafety committees to ensure compliance with current regulations, as guidelines may be updated over time.

How should laboratory safety protocols be adapted for work with recombinant ndhE?

Laboratory safety protocols for work with recombinant ndhE should follow standard practices for recombinant protein research, with specific adaptations based on the protein's properties:

• Risk assessment considerations:

  • ndhE is a non-toxic chloroplast protein with no known pathogenic properties

  • Standard Biosafety Level 1 (BSL-1) practices are typically sufficient

  • Risk level may increase depending on the expression system used

• Personal protective equipment (PPE):

  • Laboratory coat

  • Gloves

  • Eye protection when handling solutions that might splash

• Waste management:

  • Decontamination of recombinant materials before disposal

  • Proper labeling of recombinant waste

  • Adherence to institutional guidelines for biohazardous waste disposal

• Storage and handling:

  • Store purified recombinant ndhE at -20°C for short-term storage or -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Consider adding stabilizing agents (glycerol, reducing agents) if protein stability is a concern

• Emergency procedures:

  • Standard spill protocols for biological materials

  • Incident reporting procedures according to institutional policies

These protocols should be adjusted based on the specific research context and in consultation with the institutional biosafety committee.

How can recombinant ndhE be used to study photosynthetic differences between wild and domesticated rice?

Recombinant ndhE can serve as a valuable tool for investigating photosynthetic differences between wild and domesticated rice species:

• Functional characterization across species:

  • Compare enzymatic properties of ndhE from O. nivara, O. rufipogon, and O. sativa to identify functional differences that may impact photosynthetic efficiency .

  • Analyze how sequence variations affect protein-protein interactions within the NAD(P)H dehydrogenase complex.

• Dynamic light response studies:

  • Previous research has identified differences in photosynthetic induction between wild and domesticated rice in dynamic light conditions .

  • Recombinant ndhE can be used to study how the NAD(P)H dehydrogenase complex from different rice species contributes to these differences under fluctuating light conditions that mimic natural environments.

• Integration with introgression line studies:

  • Using introgression lines, researchers have developed genomic libraries incorporating segments of O. nivara into elite rice cultivars .

  • These lines can be used to study how wild-type ndhE affects photosynthetic parameters when integrated into the cultivated rice background.

• Comparative stress response analysis:

  • Wild rice species like O. nivara often show enhanced resilience to environmental stresses.

  • Recombinant ndhE can help determine if differences in the NAD(P)H dehydrogenase complex contribute to stress tolerance under conditions such as high light, drought, or temperature fluctuations.

This research direction is particularly relevant considering that researchers have previously focused on photosynthesis in constant high light, whereas plants in field conditions experience dynamic light environments due to clouds, overlying leaves, and sun movement .

What role might ndhE play in the adaptation of Oryza nivara to seasonally dry habitats?

The potential role of ndhE in the adaptation of Oryza nivara to seasonally dry habitats can be hypothesized based on its function and the ecological niche of the species:

• Cyclic electron flow optimization:

  • The NAD(P)H dehydrogenase complex, of which ndhE is a component, contributes to cyclic electron flow around photosystem I.

  • This process is crucial for maintaining the proper ATP/NADPH ratio needed for carbon fixation under stress conditions .

  • In seasonally dry habitats, optimized cyclic electron flow may provide O. nivara with enhanced ability to maintain photosynthesis under water limitation.

• Photoprotection mechanisms:

  • The NAD(P)H dehydrogenase complex may contribute to photoprotection by dissipating excess excitation energy under high light conditions.

  • O. nivara, which grows in open habitats with potentially high light exposure, might have evolved specific adaptations in this complex to manage light stress.

• Integration with cellular stress responses:

  • Research on N-rich proteins (NRPs) in Oryza species has shown their involvement in endoplasmic reticulum stress responses triggered by pathogen infection .

  • Similarly, components of the photosynthetic apparatus like ndhE might have specialized roles in coordinating responses to environmental stresses.

• Ecological context:

  • O. nivara has evolved an annual life form, photoperiod insensitivity, and predominantly self-pollinated reproductive strategy, which are adaptations to seasonally dry habitats .

  • The evolution of these traits from a perennial ancestor resembling O. rufipogon was associated with an ecological shift from persistently wet to seasonally dry habitats .

  • Changes in photosynthetic components like ndhE might be part of this adaptive package.

Experimental approaches combining recombinant protein studies with physiological measurements in wild and cultivated rice under controlled drought conditions could help elucidate the specific role of ndhE in drought adaptation.

How can QTL analysis of Oryza nivara introgression lines contribute to understanding ndhE function and evolution?

QTL analysis of Oryza nivara introgression lines (ILs) offers a powerful approach to understanding ndhE function and evolution:

• Development of appropriate genetic materials:

  • High-resolution genetic mapping populations, such as the 131 introgression lines developed between O. nivara accession W2014 and the elite indica rice variety 93-11 , provide ideal materials for QTL analysis.

  • These lines cover approximately 95% of the O. nivara genome, creating a relatively complete genomic library for mapping traits .

• Identification of photosynthesis-related QTLs:

  • QTL analysis can identify genomic regions associated with photosynthetic efficiency, electron transport rates, and responses to varying light conditions.

  • If these QTLs co-localize with the ndhE locus or other components of the NAD(P)H dehydrogenase complex, it suggests functional significance of these genes in photosynthetic variation.

• Advanced genomic characterization:

  • Whole-genome resequencing of ILs and parents can generate high-density genetic maps, as demonstrated in previous studies with 1,070 bin-markers and an average bin length of 349 kb .

  • Such resolution allows precise mapping of genes and regulatory elements affecting ndhE expression and function.

• Evolutionary insights:

  • Comparison of allelic variation at the ndhE locus between O. nivara and cultivated rice can reveal selection patterns during domestication.

  • Analysis of the genomic regions harboring ndhE could identify signatures of selection that might indicate its role in adaptation to different environments.

• Integration with phenotypic data:

  • ILs showing significant variation in photosynthetic parameters can be selected for detailed molecular analysis of ndhE expression and protein function.

  • This integrated approach can connect genetic variation to biochemical function and ultimately to whole-plant phenotypes.

In a previous study with O. nivara ILs, 65 QTLs were detected for 13 yield-related traits across two environments, with O. nivara alleles conferring improving effects on yield-associated traits at approximately 36.9% of the detected QTLs . Similar approaches could be applied specifically to photosynthetic traits to understand the contribution of genes like ndhE.

What are common challenges in expressing and purifying membrane-associated proteins like ndhE?

Membrane-associated proteins like ndhE present several technical challenges during expression and purification:

• Expression challenges:

  • Toxicity to host cells due to membrane disruption

  • Protein misfolding and aggregation leading to inclusion body formation

  • Low expression levels compared to soluble proteins

  • Difficulties in proper insertion into host membranes

• Solubilization issues:

  • Finding appropriate detergents that maintain protein structure and function

  • Balancing detergent concentration to effectively solubilize without denaturing

  • Potential loss of interacting partners that may be necessary for stability

• Purification complications:

  • Detergent micelles can interfere with binding to chromatography matrices

  • Co-purification of host membrane proteins and lipids

  • Reduced stability during purification steps leading to loss of activity

  • Difficulties in removing detergent if needed for downstream applications

• Quality assessment challenges:

  • Limited methods to assess proper folding in a detergent environment

  • Difficulties in activity assays due to the need for lipid or membrane environments

  • Challenges in distinguishing between monomeric and oligomeric states

How should experiments be designed to optimize soluble expression of recombinant ndhE?

To optimize soluble expression of recombinant ndhE, a systematic experimental design approach should be implemented:

• Selection of expression system:

  • Consider specialized expression systems designed for membrane proteins

  • Evaluate E. coli strains with enhanced membrane protein expression capabilities

  • Explore eukaryotic systems if proper folding is challenging in prokaryotes

• Vector design considerations:

  • Include solubility-enhancing fusion partners (MBP, SUMO, Trx)

  • Optimize codon usage for the host organism

  • Consider inducible promoters with tunable expression levels

  • Include appropriate signal sequences if targeting to membranes is desired

• Statistical experimental design:

  • Implement a factorial design examining key variables :

    • Induction temperature (lower temperatures often favor folding)

    • Inducer concentration (lower levels may reduce aggregation)

    • Host cell density at induction

    • Post-induction time

    • Media composition

  • Include center points to evaluate experimental variability

  • Use response surface methodology to identify optimal conditions

• Initial screening protocol:

  • Small-scale expression trials with varying conditions

  • Rapid analysis of soluble vs. insoluble fractions

  • Western blot analysis to detect expression levels

  • Activity assays to confirm functional protein production

A multivariate optimization approach like this has been shown to successfully improve soluble expression of challenging proteins by identifying important variable interactions that might be missed in traditional optimization approaches .

What analytical methods are most suitable for characterizing the structure-function relationship of ndhE?

Characterizing the structure-function relationship of ndhE requires a multifaceted analytical approach:

• Structural analysis techniques:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Fluorescence spectroscopy to probe tertiary structure and environment of aromatic residues

  • Nuclear magnetic resonance (NMR) for detailed structural information in solution

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination (likely as part of the complete complex)

• Functional characterization methods:

  • Electron transport assays measuring NAD(P)H oxidation rates

  • Quinone reduction assays using various electron acceptors

  • Membrane potential measurements in reconstituted systems

  • Hydrogen peroxide production assessment as a measure of electron leakage

• Interaction studies:

  • Blue native PAGE to analyze intact complex formation

  • Surface plasmon resonance to measure binding kinetics with partner proteins

  • Cross-linking coupled with mass spectrometry to identify interaction interfaces

  • Co-immunoprecipitation to verify protein-protein interactions in vivo

• Structure-function correlation approaches:

  • Site-directed mutagenesis of conserved residues to assess their role in function

  • Chimeric proteins combining segments from different species to identify functional domains

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamic regions and conformational changes

  • Computational modeling and molecular dynamics simulations to predict functional mechanisms

• In vivo validation:

  • Complementation studies in model organisms lacking endogenous ndhE

  • Physiological measurements of photosynthetic parameters in plants with modified ndhE

  • Analysis of plant response to environmental stresses with wild-type versus mutant ndhE

This comprehensive approach would provide insights into both the structural features and functional significance of ndhE in the context of photosynthetic electron transport.

How might advances in genome editing technologies be applied to study ndhE function in Oryza species?

Genome editing technologies offer powerful new approaches to study ndhE function in Oryza species:

• CRISPR-Cas9 applications:

  • Targeted gene knockout to eliminate ndhE function and assess phenotypic consequences

  • Introduction of specific mutations to study structure-function relationships

  • Base editing to introduce single nucleotide polymorphisms found in different Oryza species

  • Prime editing for precise modifications without requiring double-strand breaks

• Comparative analysis across species:

  • Creation of isogenic lines differing only in the ndhE sequence from O. nivara versus O. sativa

  • Introduction of wild rice ndhE alleles into cultivated backgrounds to assess functional differences

  • Replacement of cultivated rice ndhE with wild variants to evaluate adaptation to stress conditions

• Regulatory element analysis:

  • Editing promoter regions to understand transcriptional regulation of ndhE

  • Creation of reporter constructs to monitor ndhE expression under different environmental conditions

  • Investigation of cis-regulatory elements specific to O. nivara compared to cultivated rice

• Protein-level modifications:

  • Introduction of epitope tags for in vivo tracking without disrupting function

  • Addition of fluorescent protein fusions to study subcellular localization and dynamics

  • Creation of conditional degron systems to study temporal aspects of ndhE function

• High-throughput phenotyping integration:

  • Combined with imaging technologies to assess photosynthetic efficiency

  • Integration with metabolomic approaches to identify downstream effects of ndhE modification

  • Field testing of edited plants under varying environmental conditions to evaluate agronomic impact

These approaches would significantly advance our understanding of ndhE function in photosynthesis and potentially identify novel targets for improving photosynthetic efficiency in cultivated rice.

What are the potential applications of recombinant ndhE in improving rice photosynthetic efficiency under variable light conditions?

Recombinant ndhE has several potential applications for improving rice photosynthetic efficiency under variable light conditions:

These applications have significant potential considering that field conditions rarely provide constant light, and improvements in dynamic light response could translate to meaningful yield increases.

How can systems biology approaches integrate ndhE function into broader models of photosynthetic adaptation in rice?

Systems biology approaches offer powerful frameworks for integrating ndhE function into comprehensive models of photosynthetic adaptation in rice:

• Multi-omics integration:

  • Combining genomics, transcriptomics, proteomics, and metabolomics data to map the network of interactions involving ndhE.

  • Correlation of genetic variation in ndhE with expression patterns, protein abundance, and metabolite profiles across diverse rice germplasm.

• Mathematical modeling of photosynthesis:

  • Incorporation of ndhE-mediated cyclic electron flow into quantitative models of photosynthetic electron transport.

  • Development of dynamic models that predict photosynthetic responses to fluctuating light based on ndhE variants.

  • Sensitivity analysis to identify the relative importance of ndhE compared to other components of the photosynthetic apparatus.

• Network analysis:

  • Construction of gene co-expression networks to identify modules associated with ndhE function.

  • Protein-protein interaction networks to place ndhE in the context of its functional partners.

  • Metabolic flux analysis to quantify the impact of ndhE variation on carbon assimilation and energy balance.

• Evolutionary systems biology:

  • Comparative analysis of ndhE across Oryza species to identify signatures of selection.

  • Reconstruction of evolutionary trajectories to understand how photosynthetic adaptation contributed to rice domestication.

  • Identification of co-evolved gene clusters that might functionally interact with ndhE.

• Integration with environmental response data:

  • Linking ndhE function to ecophysiological measurements across diverse environments.

  • Development of predictive models for how different ndhE variants will perform under various climate scenarios.

  • Integration with crop growth models to predict yield impacts of photosynthetic adaptations.