Recombinant Oryza nivara NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPTFSAFSLGLVLVCISLFYILLNSYFVAV AQLLIYVGAINVLIIFAVMFVNGSEWSKDKNFWTIGDGFTSLVCITIPFSLMTTIPDTSW YGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ
Uniprot No.

Target Background

Function

NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this organism, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase and its role in Oryza nivara?

NAD(P)H-quinone oxidoreductase (also known as NAD(P)H dehydrogenase) is a flavoprotein complex that catalyzes the two-electron reduction of quinones and quinonoid compounds to hydroquinones, using either NADH or NADPH as electron donors . In chloroplasts of Oryza nivara (Indian wild rice), this protein complex plays crucial roles in cyclic electron transport around photosystem I and chlororespiration. The complex transfers electrons to quinones without accumulating semiquinone intermediates, which helps prevent oxidative damage . In Oryza nivara's chloroplast genome, which spans 134,494 bp, these genes are encoded in a pattern identical to that of cultivated rice (Oryza sativa), though with specific sequence variations that may affect function .

How does the genetic structure of Oryza nivara chloroplast genes compare to cultivated rice?

The chloroplast genome of Oryza nivara has been completely sequenced and compared with Oryza sativa, revealing significant insights:

FeatureOryza nivaraOryza sativaNotes
Total genome length134,494 bpSimilar to O. sativaIncludes all functional genes
Large single-copy region80,544 bpSimilar structural organizationContains many photosynthetic genes
Small single-copy region12,346 bpSimilar structural organizationContains various genes including ndh genes
Inverted repeatsTwo repeats of 20,802 bp eachSimilar structural organizationContain duplicated genes
A+T content61.0%SimilarTypical for plant chloroplast genomes
Genetic variations57 insertions, 61 deletions, 159 base substitutionsReference genomeMost insertions/deletions are single-base

Despite these variations, the O. nivara chloroplast genome encodes identical functional genes to O. sativa in the same order along the genome, including the NAD(P)H-quinone oxidoreductase subunits . The frequency of insertion/deletion events is higher in coding regions within inverted repeats, while substitution events in coding regions are relatively rare .

What experimental systems are appropriate for studying recombinant Oryza nivara chloroplastic proteins?

Escherichia coli expression systems are widely used for recombinant production of Oryza nivara chloroplastic proteins, including NAD(P)H-quinone oxidoreductase subunits . When expressing chloroplastic proteins, researchers should consider codon optimization for E. coli, as plant chloroplast genes may contain codons that are rare in bacteria. For functional studies, it's essential to ensure proper folding and, if applicable, cofactor incorporation. The recombinant proteins can be purified to >85% using SDS-PAGE verification methods . When designing experimental systems, researchers should include proper controls with purified protein to differentiate between effects caused by the protein itself versus those from the expression system or contaminants.

What are the optimal protocols for expressing and purifying recombinant Oryza nivara chloroplastic proteins?

For optimal expression and purification of recombinant Oryza nivara chloroplastic proteins:

  • Expression system selection: E. coli is the preferred heterologous expression system for chloroplastic proteins from Oryza nivara, as demonstrated with recombinant ndhF .

  • Vector design: Include appropriate promoters (typically T7 or tac) and a purification tag determined during the manufacturing process. Consider adding a transit peptide removal site if the native protein includes a transit peptide.

  • Culture conditions: Optimize temperature (typically 16-30°C), induction time, and inducer concentration to maximize soluble protein production.

  • Purification protocol: Implement a multi-step purification strategy that typically includes:

    • Affinity chromatography based on the fusion tag

    • Size exclusion chromatography

    • Ion exchange chromatography if needed

  • Quality control: Verify purity using SDS-PAGE (aim for >85% purity as a minimum standard) . Western blotting can confirm protein identity.

  • Functional validation: Enzyme activity assays specific to NAD(P)H-quinone oxidoreductase function should be performed to ensure the recombinant protein is functional.

How should researchers store and handle recombinant chloroplastic proteins to maintain stability and activity?

Proper storage and handling of recombinant chloroplastic proteins is critical for maintaining their stability and activity:

  • Long-term storage:

    • Lyophilized form: Store at -20°C/-80°C for up to 12 months

    • Liquid form: Store at -20°C/-80°C for up to 6 months

    • Divide into small working aliquots to avoid repeated freeze-thaw cycles

  • Short-term storage:

    • Store working aliquots at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Handling precautions:

    • Avoid repeated freeze-thaw cycles, as this can significantly reduce protein activity

    • Maintain appropriate pH and ionic strength conditions

    • Consider adding reducing agents if the protein contains sensitive cysteine residues

Researchers should note that shelf life is influenced by multiple factors, including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the specific protein .

What statistical approaches are recommended for analyzing experimental data involving recombinant Oryza proteins?

When analyzing experimental data involving recombinant Oryza proteins, consider the following statistical approaches:

  • Analysis of variance (ANOVA) and analysis of covariance (ANACOV) to identify factors that influence the variation of measured parameters. These analyses can help determine the minimum number of data sets needed to summarize experimental results effectively .

  • Treatment comparisons: When interactions among treatment factors are not significant but single-factor treatment effects are significant, tabulate treatment means along with standard deviations for easy reference .

  • Reliability assessment: Calculate the coefficient of variation (CV) to express the degree of experimental error and assess the reliability of experiments. Acceptable CV ranges vary by experiment type; for rice studies, appropriate ranges are:

    • 6-8% for variety trials

    • 10-12% for fertilizer trials

    • 13-15% for pesticide trials

  • Model calibration and evaluation: Use at least two independent data sets:

    • One data set under optimal conditions (ample water and nutrients, no pests or diseases) for model calibration

    • Additional data sets (other treatments) for model evaluation

  • Enzyme kinetics analysis: For NAD(P)H-quinone oxidoreductase functional studies, apply both steady-state and rapid-reaction kinetics to determine reaction mechanisms .

How can researchers utilize Oryza nivara introgression lines to study chloroplastic gene function?

Introgression lines (ILs) represent a powerful tool for studying the function of Oryza nivara chloroplastic genes in the genetic background of cultivated rice. Researchers can develop and utilize ILs through the following methodology:

  • Development approach: Create ILs by introducing O. nivara segments into an elite rice variety background (such as indica rice 93-11) through advanced backcrossing and repeated selfing .

  • Genomic characterization: Use whole-genome resequencing to develop high-density genetic maps of the introgression lines. For example, a set of 131 ILs was mapped with 1,070 bin-markers, with an average bin length of 349 kb .

  • Coverage assessment: Ensure the ILs collectively cover a high percentage of the O. nivara genome (e.g., 95% coverage), providing a relatively complete genomic library for studying gene function .

  • QTL mapping: Map quantitative trait loci (QTLs) for traits of interest across multiple environments. This approach has successfully identified 65 QTLs across two environments for 13 yield-related traits, with approximately 36.9% of QTLs showing O. nivara alleles with positive effects on yield-associated traits .

  • Candidate gene identification: Use the ILs to identify candidate genes governing traits of interest. Several known genes, including Sh4/SHA1, Bh4, Sd1, TE/TAD1, GS3, and FZP, have been colocalized in peak intervals of 9 QTLs in previous studies .

This approach enables researchers to identify and utilize beneficial alleles from wild rice such as O. nivara while providing a foundation for fine mapping and cloning of favorable O. nivara-derived genes, including chloroplastic genes like those encoding NAD(P)H-quinone oxidoreductase subunits.

What structure-function relationships in NAD(P)H-quinone oxidoreductase inform research on specific subunits?

Understanding structure-function relationships in NAD(P)H-quinone oxidoreductase proteins provides crucial insights for studying specific subunits like ndhG:

  • Reaction mechanism: NAD(P)H-quinone oxidoreductase catalyzes two-electron reduction of quinones to hydroquinones without accumulating dissociated semiquinones, using either NADH or NADPH as electron donors . This mechanism is critical for preventing oxidative stress in chloroplasts.

  • Subunit interactions: Multiple subunits work cooperatively to transfer electrons efficiently. The chloroplastic complex contains several subunits (including ndhG) that must be properly assembled for function. Studies of chimeric proteins and site-directed mutagenesis have helped determine the molecular basis of catalytic differences between isozymes and identify critical amino acid residues that interact with various inhibitors .

  • Functional domains: Analysis of the natural occurring mutant Pro-187 to Ser (P187S) has provided insights into how specific amino acid changes affect protein function . Similar analyses can inform research on ndhG subunit-specific mutations.

  • Evolutionary conservation: Comparative genomic analyses between Oryza nivara and Oryza sativa have revealed that while the chloroplast genomes encode identical functional genes in the same order, there are specific sequence variations, including 57 insertions, 61 deletions, and 159 base substitutions . These variations may affect the structure-function relationships of proteins like NAD(P)H-quinone oxidoreductase.

  • Isozyme comparisons: Studies comparing DT-diaphorase (NQO1) and NRH:quinone oxidoreductase (NQO2) show that despite high nucleotide sequence identity, these isozymes have distinct functions . This approach can be applied to understanding different subunits of the chloroplastic NAD(P)H-quinone oxidoreductase complex.

These structure-function insights can guide research approaches for studying specific subunits like ndhG, informing experimental design for site-directed mutagenesis, protein engineering, and functional characterization.

How do variations in chloroplast genomic structure between wild and cultivated rice affect protein function studies?

Variations in chloroplast genomic structure between wild Oryza nivara and cultivated Oryza sativa have several implications for protein function studies:

  • Sequence variation patterns: The chloroplast genome of O. nivara shows 57 insertions, 61 deletions, and 159 base substitutions compared to O. sativa . Among substitutions, transversions occur more frequently than transitions, especially in coding regions, potentially affecting protein structure and function.

  • Distribution of variations: Most insertions/deletions are single-base, though some larger mutations exist. Insertion/deletion events occur more frequently in coding regions within inverted repeats, while substitution events in coding regions are relatively rare . This pattern suggests selection pressure to maintain protein function.

  • Functional conservation: Despite these variations, O. nivara chloroplast genome encodes identical functional genes to O. sativa in the same order . This suggests evolutionary conservation of essential functions while allowing for potential fine-tuning of activity through subtle sequence variations.

  • Protein expression strategy: When expressing recombinant O. nivara chloroplastic proteins, researchers should consider these sequence variations in primer design, codon optimization, and functional validation.

  • Polymorphic regions: Polymorphism observed among rice cultivars at loci of large insertion/deletion events provides potential targets for investigating functional differences in chloroplastic proteins between wild and cultivated rice.

Understanding these genomic variations provides context for interpreting functional studies of chloroplastic proteins, including NAD(P)H-quinone oxidoreductase subunits, and may reveal evolutionary adaptations in wild rice that could be valuable for crop improvement.

What NIH guidelines apply to experiments involving recombinant Oryza nivara proteins?

Researchers working with recombinant Oryza nivara proteins should be aware of the following NIH Guidelines considerations:

While the recombinant proteins themselves are not subject to NIH Guidelines, the processes used to create them may be. Researchers should maintain appropriate documentation of compliance with applicable regulations.

What quality control measures should be implemented when working with recombinant plant proteins?

Rigorous quality control is essential when working with recombinant plant proteins such as Oryza nivara NAD(P)H-quinone oxidoreductase subunits:

  • Purity assessment: Verify protein purity using SDS-PAGE analysis, aiming for >85% purity as a minimum standard . Consider additional analytical methods such as size exclusion chromatography or mass spectrometry for more detailed purity analysis.

  • Identity confirmation: Confirm protein identity through:

    • Western blotting with specific antibodies

    • Mass spectrometry peptide fingerprinting

    • N-terminal sequencing

    • Functional assays specific to the protein

  • Activity validation: Measure enzymatic activity using substrate-specific assays. For NAD(P)H-quinone oxidoreductase, this typically involves monitoring the reduction of quinone substrates using spectrophotometric methods.

  • Stability monitoring: Implement regular stability testing of stored protein samples to ensure activity is maintained over time. Compare activity levels of fresh vs. stored samples to establish degradation rates under different storage conditions.

  • Contaminant testing: Test for potential contaminants, particularly:

    • Endotoxin levels (especially for E. coli-expressed proteins)

    • Host cell protein content

    • Nucleic acid contamination

  • Batch consistency: Establish standard operating procedures (SOPs) for production and purification to ensure batch-to-batch consistency. Include reference standards in quality control testing.

  • Documentation: Maintain comprehensive records of all quality control tests, including raw data, analysis methods, and results interpretation.

Implementing these quality control measures helps ensure experimental reproducibility and reliability of research findings involving recombinant Oryza nivara proteins.

How can researchers address common challenges in expressing and purifying chloroplastic recombinant proteins?

Chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunits present several expression and purification challenges that researchers can address using these strategies:

  • Protein solubility issues:

    • Lower expression temperature (16-18°C) to slow protein synthesis and improve folding

    • Co-express with molecular chaperones to assist protein folding

    • Use solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Optimize induction conditions (lower IPTG concentration, longer induction time)

  • Inclusion body formation:

    • Develop refolding protocols using sequential dialysis with decreasing denaturant concentrations

    • Include appropriate cofactors during refolding if applicable

    • Consider using specialized strains designed for difficult-to-express proteins

  • Low yield:

    • Optimize codon usage for E. coli expression

    • Test different promoter systems and expression strains

    • Scale up culture volume while maintaining optimal conditions

  • Protein degradation:

    • Include protease inhibitors during purification

    • Reduce purification time by optimizing protocols

    • Store with appropriate stabilizing agents (glycerol at 5-50%)

  • Loss of activity during storage:

    • Avoid repeated freeze-thaw cycles

    • Store lyophilized form at -20°C/-80°C (stable for up to 12 months)

    • For liquid forms, store at -20°C/-80°C (stable for up to 6 months)

    • Keep working aliquots at 4°C for no more than one week

  • Purification difficulties:

    • Implement multi-step purification strategies

    • Optimize buffer conditions (pH, salt concentration, reducing agents)

    • Consider alternative chromatography methods if initial approaches fail

By systematically addressing these challenges, researchers can improve the yield, purity, and activity of recombinant chloroplastic proteins from Oryza nivara.

What approaches help resolve contradictory results in functional studies of NAD(P)H-quinone oxidoreductase subunits?

When facing contradictory results in functional studies of NAD(P)H-quinone oxidoreductase subunits, researchers can employ these methodological approaches:

  • Replicate with standardized conditions: Ensure experimental conditions are identical across replications. For rice-related experiments, aim for coefficient of variation (CV) within acceptable ranges (6-8% for variety trials, 10-12% for fertilizer trials) .

  • Multiple kinetic analysis methods: Employ both steady-state and rapid-reaction kinetic experiments to comprehensively determine reaction mechanisms . Compare results from different methodological approaches to identify consistent findings.

  • Structure-function correlation: Use chimeric and site-directed mutagenesis experiments to determine the molecular basis of catalytic differences and identify critical amino acid residues . This approach can help resolve contradictions by linking functional differences to specific structural features.

  • Isozyme comparisons: Compare results with related isozymes like NQO1 and NQO2 to identify patterns in structure-function relationships . This comparative approach can provide context for interpreting contradictory results.

  • Natural variant analysis: Study natural variants like the Pro-187 to Ser (P187S) mutation to understand how sequence variations affect function . This approach can help explain contradictory results that might stem from subtle sequence differences.

  • Multiple expression systems: Test protein function in different expression systems to rule out host-specific effects.

  • Independent data sets for model validation: Use at least two independent data sets—one for model calibration under optimal conditions and others for model evaluation under various treatments . This approach helps validate findings across different experimental conditions.

By systematically applying these approaches, researchers can resolve contradictions and develop more robust models of NAD(P)H-quinone oxidoreductase subunit function.

How can Oryza nivara chloroplastic proteins contribute to crop improvement strategies?

Oryza nivara chloroplastic proteins, including NAD(P)H-quinone oxidoreductase subunits, offer significant potential for crop improvement:

  • Introgression of beneficial alleles: Approximately 36.9% of QTLs derived from O. nivara show positive effects on yield-associated traits . Chloroplastic genes like those encoding NAD(P)H-quinone oxidoreductase subunits may contribute to these beneficial effects through improved photosynthetic efficiency or stress response.

  • Expanded genetic diversity: The 131 introgression lines (ILs) covering 95% of the O. nivara genome provide a relatively complete genomic library for exploring and utilizing beneficial alleles from wild rice . This resource enables systematic investigation of chloroplastic gene variants.

  • Stress tolerance improvement: NAD(P)H-quinone oxidoreductase plays important roles in preventing oxidative damage . Wild rice variants of these proteins may confer enhanced stress tolerance that could be transferred to cultivated varieties.

  • Photosynthetic efficiency enhancement: As components of chloroplastic electron transport, optimized variants of these proteins might improve photosynthetic efficiency, potentially increasing yield under various environmental conditions.

  • Molecular breeding targets: The high-density genetic map containing 1,070 bin-markers (average length 349 kb per bin) provides precise targets for molecular breeding approaches , allowing for targeted improvement of specific traits related to chloroplastic function.

Future research should focus on fine mapping and cloning of the favorable O. nivara-derived QTLs , particularly those related to chloroplastic functions, and developing breeding strategies to incorporate these beneficial alleles into elite cultivars for sustainable crop improvement.

What emerging technologies might advance research on chloroplastic proteins from wild rice species?

Several emerging technologies hold promise for advancing research on chloroplastic proteins from wild rice species:

  • CRISPR-Cas genome editing: Precise modification of chloroplastic genes or their nuclear regulators to study function and create novel variants with improved properties. This approach allows direct testing of hypotheses about specific amino acid changes in proteins like NAD(P)H-quinone oxidoreductase subunits.

  • Single-molecule enzymology: Advanced techniques for studying the kinetics and mechanisms of individual enzyme molecules can reveal functional heterogeneity and rare catalytic events in NAD(P)H-quinone oxidoreductase complexes.

  • Cryo-electron microscopy: High-resolution structural analysis of chloroplastic protein complexes from wild rice species can reveal subtle structural differences that explain functional variations between wild and cultivated rice.

  • Nanopore sequencing: Long-read sequencing technologies enable more complete and accurate assembly of wild rice genomes, including complex regions that might contain novel chloroplastic gene variants.

  • Proteomics and metabolomics integration: Multi-omics approaches that integrate protein-level and metabolite-level data can provide comprehensive understanding of how chloroplastic proteins function within cellular networks.

  • Machine learning for protein engineering: Computational approaches to predict how sequence variations affect protein function, guiding targeted modifications of chloroplastic proteins for desired properties.

  • High-throughput phenotyping: Advanced phenotyping platforms to rapidly assess the effects of chloroplastic protein variations on plant performance under various environmental conditions.

These technologies, when applied to the study of chloroplastic proteins from Oryza nivara and other wild rice species, will accelerate discovery of valuable genetic resources for crop improvement while advancing fundamental understanding of chloroplastic protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.