Recombinant Oryza nivara Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryza nivara Photosystem I Assembly Protein Ycf4 (ycf4)

The Recombinant Oryza nivara Photosystem I assembly protein Ycf4 (ycf4) is a protein crucial for the assembly of Photosystem I (PSI) in various photosynthetic organisms . Ycf4 is encoded by the chloroplast genome and is highly conserved across species, from cyanobacteria to higher plants . It plays a vital role in the biogenesis of PSI, a large multi-subunit complex in the thylakoid membrane responsible for light-dependent electron transfer .

Genetic and Molecular Analysis

  • Chloroplast Genome Encoding: The ycf4 gene is encoded by the chloroplast genome and is part of the rps9-ycf4-ycf3-rps18 polycistronic transcriptional unit in C. reinhardtii .

  • Mutant Phenotypes: Inactivation of ycf4 leads to a deficiency in PSI activity and the inability of mutant cells to grow photoautotrophically . The accumulation of PSI subunits is nearly undetectable in these mutants .

  • ycf4 Knockout Plants: In higher plants, ycf4 knockout plants are viable but show reduced photosynthetic performance and specific deficiencies in PSI accumulation .

Interaction with Other Proteins

  • COP2: Ycf4 interacts intimately and exclusively with COP2 . Although COP2 is not essential for PSI assembly, it affects the salt sensitivity and stability of the Ycf4 complex .

  • Ycf3: Ycf4 and Ycf3 are required for the stable accumulation of the PSI complex . Ycf3-HA mutants accumulate Ycf4 and a diagnostic PSI core protein (PSAF) at wild-type levels .

  • Y3IP1: Y3IP1 is another auxiliary factor involved in PSI assembly. The contents of Ycf4 and Y3IP1 decrease with increasing leaf age, suggesting that PSI biogenesis is restricted to young leaves .

Data Tables

FeatureDescription
Protein SizeApproximately 22 kD
LocationThylakoid membrane
Essentiality (C. reinhardtii)Essential for PSI accumulation and photoautotrophic growth
Essentiality (Higher Plants)Non-essential but contributes to efficient PSI assembly
InteractionsCOP2, PsaA, PsaB, PsaC, PsaD, PsaE, PsaF, Ycf3, Y3IP1
OrganismPhenotype of ycf4 Mutant
Chlamydomonas reinhardtiiDeficiency in PSI activity, inability to grow photoautotrophically, reduced PSI subunit accumulation
Nicotiana tabacumReduced photosynthetic performance, specific deficiency in PSI accumulation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWIELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGKNIISVLPSQQILFF PQGVVMSFYGIAGLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRF LMRDIQSIRIQVKEGLFPRRILYMEIRGQGAIPLTRTDEKFFTPREIEQKAAELAYFLRI PMEVF
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How conserved is ycf4 across rice species compared to other photosynthetic organisms?

The conservation pattern suggests that while ycf4's function in PSI assembly is maintained across photosynthetic organisms, its sequence has evolved considerably, potentially reflecting adaptation to specific photosynthetic requirements or environmental conditions. Researchers should consider these evolutionary divergences when designing experiments involving heterologous expression or functional complementation.

What is the established function of Ycf4 in photosystem assembly?

Ycf4 has been conclusively demonstrated to play an essential role in photosystem I (PSI) assembly. Studies in Chlamydomonas reinhardtii revealed that Ycf4 forms a large stable complex (>1500 kD) that contains PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Pulse-chase protein labeling experiments confirmed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled, indicating that the Ycf4 complex functions as a scaffold for PSI assembly .

What are the most effective methods for isolating and expressing recombinant Ycf4 from Oryza nivara?

Isolation of Native Ycf4:

  • Chloroplast Isolation: Begin with fresh O. nivara leaf tissue and isolate intact chloroplasts using differential centrifugation in sorbitol-containing buffers.

  • Thylakoid Membrane Preparation: Lyse chloroplasts and separate thylakoid membranes through ultracentrifugation.

  • Membrane Protein Solubilization: Solubilize membrane proteins using mild detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) that preserve protein-protein interactions.

  • Affinity Purification: Similar to studies in Chlamydomonas, utilize tandem affinity purification (TAP) tags for Ycf4 isolation .

Recombinant Expression:

  • Gene Synthesis: Design a codon-optimized ycf4 sequence based on the O. nivara chloroplast genome.

  • Expression System Selection: Choose between bacterial (E. coli), yeast, or plant-based expression systems depending on research goals.

  • Fusion Tag Strategy: Incorporate affinity tags (His, GST, or MBP) to facilitate purification while considering their potential impact on protein folding and function.

  • Membrane Protein Expression: Use specialized expression vectors designed for membrane proteins, potentially with signal sequences directing insertion into appropriate membrane systems.

For functional studies, bacterial expression may be sufficient for structural analyses, while plant-based systems might better preserve native functionality when assessing protein-protein interactions.

What approaches can be used to study Ycf4-mediated protein-protein interactions in PSI assembly?

In Vitro Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Ycf4 or suspected interacting partners to pull down protein complexes, followed by immunoblotting or mass spectrometry.

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between purified Ycf4 and PSI components.

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of interactions.

In Vivo Methods:

  • Bimolecular Fluorescence Complementation (BiFC): By tagging Ycf4 and potential interacting partners with split fluorescent protein fragments and expressing in plant cells.

  • Förster Resonance Energy Transfer (FRET): Using fluorescently labeled proteins to detect proximity-based interactions in living cells.

  • Split-Ubiquitin Yeast Two-Hybrid System: Specifically designed for membrane protein interactions.

Proteomics Approach:

  • Tandem Affinity Purification-Mass Spectrometry (TAP-MS): Similar to the approach used with Chlamydomonas Ycf4, where a TAP-tagged Ycf4 was used to purify a large stable complex containing PSI subunits .

  • Cross-linking Mass Spectrometry: To capture transient interactions during the assembly process.

Structural Methods:

  • Cryo-Electron Microscopy: To visualize the architecture of the Ycf4-PSI assembly complex, as studies in Chlamydomonas revealed particles measuring 285 × 185 Å that may represent oligomeric states of the complex .

How can site-directed mutagenesis be applied to study functional domains of O. nivara Ycf4?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationship of Ycf4. Based on studies in other organisms, several key strategies can be implemented:

  • Target Selection Based on Conservation:

    • Identify highly conserved residues across species that may be functionally critical

    • Focus on charged amino acids (like R120, E179, and E181 identified in other studies) that often participate in protein-protein interactions

    • Target regions predicted to be involved in membrane anchoring or protein binding

  • Mutation Design Strategy:

    • Conservative substitutions (e.g., E→D, R→K) to test charge importance while minimizing structural disruption

    • Non-conservative substitutions (e.g., E→A, E→Q) to assess the requirement for specific chemical properties

    • Create truncations to identify minimal functional domains

  • Expression System Selection:

    • For initial screening, heterologous systems like E. coli may be used

    • For functional validation, transformation into ycf4-deficient plants or complementation in other model organisms

  • Functional Assays:

    • Protein stability assessment through pulse-chase experiments with translational inhibitors (chloramphenicol)

    • Protein-protein interaction assays to determine if mutations disrupt specific binding partners

    • Photosystem I assembly efficiency measurements using spectroscopic methods

  • Data Interpretation Framework:

    • Distinguish between mutations affecting protein stability versus function

    • Quantify the relationship between Ycf4 accumulation and PSI assembly

    • Consider potential compensatory mechanisms when interpreting phenotypes

Studies in other systems have revealed that mutations like R120A and R120Q significantly reduced Ycf4 stability, while mutations at E181 specifically impaired PSI accumulation despite only moderately reducing Ycf4 levels . This methodological approach helps distinguish residues important for protein stability versus those directly involved in PSI assembly.

How does the Ycf4 complex composition differ between wild Oryza nivara and cultivated rice species?

This question addresses the evolutionary implications of domestication on photosynthetic machinery. Current research indicates that while O. nivara and O. sativa share identical functional genes in the same order along the chloroplast genome, detailed analysis reveals numerous genetic variations including 57 insertions, 61 deletions, and 159 base substitution events . These differences could potentially impact the composition and function of the Ycf4 complex.

Methodological Approach:

  • Comparative Proteomics:

    • Isolate Ycf4 complexes from both species using identical protocols

    • Employ quantitative proteomics (e.g., SILAC or TMT labeling) to identify differences in complex composition

    • Analyze post-translational modifications that might differ between species

  • Structural Comparisons:

    • Use cryo-electron microscopy to visualize and compare complex architectures

    • Perform hydrogen-deuterium exchange mass spectrometry to identify regions with different solvent accessibility

  • Functional Assessment:

    • Cross-species complementation experiments to test functional equivalence

    • Measure PSI assembly kinetics in both species under various environmental conditions

Expected Challenges:

  • Controlling for environmental and developmental variables when comparing different species

  • Distinguishing primary effects of Ycf4 variation from secondary effects in the photosynthetic apparatus

  • Interpreting the adaptive significance of any observed differences

What role might O. nivara Ycf4 genetic variants play in stress adaptation?

Wild rice species like O. nivara have evolved under natural selection in diverse environments, potentially developing stress-adaptive mechanisms in their photosynthetic machinery. Research should investigate whether genetic variants of Ycf4 contribute to photosynthetic resilience under stress conditions.

Experimental Approach:

  • Identification of Natural Variants:

    • Sequence ycf4 from diverse O. nivara accessions from different ecological niches

    • Identify polymorphisms that correlate with environmental parameters

  • Functional Characterization:

    • Express identified variants in model systems lacking endogenous ycf4

    • Subject transformed lines to various stressors (high light, temperature extremes, drought)

    • Monitor PSI assembly efficiency, photosynthetic parameters, and stress response markers

  • Physiological Assessment:

    • Compare photoinhibition rates between variants under stress conditions

    • Measure PSI-to-PSII ratios and cyclic electron flow capacity

    • Assess reactive oxygen species production and antioxidant responses

This research direction could inform both fundamental understanding of photosynthetic adaptation and potential applications in developing climate-resilient crop varieties.

What is the stoichiometric relationship between Ycf4 and PSI components during assembly?

Understanding the quantitative aspects of Ycf4's role in PSI assembly presents a significant research challenge. Studies in other systems suggest that wild-type cells maintain excess Ycf4 (approximately 5-fold more than minimally required) for efficient PSI assembly .

Research Methodology:

  • Quantitative Proteomics:

    • Absolute quantification of Ycf4 and PSI subunits at different developmental stages

    • Correlation analysis between Ycf4 levels and PSI assembly rates

  • Controlled Expression Systems:

    • Develop inducible expression systems for precise control of Ycf4 levels

    • Titrate Ycf4 expression and monitor the threshold required for normal PSI assembly

  • Mathematical Modeling:

    • Develop kinetic models of PSI assembly incorporating Ycf4 complex formation

    • Test model predictions against experimental data from varying Ycf4 concentration scenarios

  • Super-Resolution Microscopy:

    • Visualize the spatial organization of Ycf4 and PSI components during assembly

    • Track the dynamic changes in complex formation using live-cell imaging

Research Questions to Address:

  • Is there a minimum threshold of Ycf4 required for normal PSI assembly?

  • Does the apparent excess of Ycf4 in wild-type cells serve specific functions under challenging environmental conditions?

  • How is the stoichiometry affected by light intensity, temperature, or other environmental factors?

How does O. nivara Ycf4 compare structurally and functionally to Ycf4 proteins in other photosynthetic organisms?

OrganismYcf4 Size (aa)Key Structural FeaturesFunctional CharacteristicsReference
Oryza nivaraVariableConserved within Oryza genusEssential for PSI assembly
Oryza sativaVariableIdentical functional domain to O. nivaraEssential for PSI assembly
Chlamydomonas reinhardtiiVariableForms complex >1500 kD with COP2Scaffold for PSI assembly
TobaccoVariableTransmembrane proteinEssential for transcriptional regulation
Onobrychis speciesVariableLow sequence identity to rice (<70%)Likely essential for PSI assembly

The structural and functional comparison reveals that while Ycf4's primary role in PSI assembly appears conserved across photosynthetic organisms, significant sequence divergence exists, particularly between distantly related taxa. This suggests potential adaptations in the mechanism of PSI assembly across evolutionary lineages.

Methodologically, researchers investigating O. nivara Ycf4 should consider:

  • Performing detailed sequence analysis using both primary sequence alignment and predicted secondary structure comparisons

  • Conducting cross-species complementation experiments to test functional conservation

  • Using ancestral sequence reconstruction to trace the evolutionary trajectory of Ycf4

  • Examining the co-evolution patterns between Ycf4 and its interaction partners in the PSI complex

What insights can chromosome segment substitution lines (CSSLs) provide about O. nivara Ycf4 function?

Chromosome segment substitution lines (CSSLs) containing O. nivara genomic segments in O. sativa backgrounds (referred to as NSLs) represent a powerful tool for investigating the functional significance of O. nivara genes, potentially including ycf4 .

Research Strategy:

  • Identification of Relevant NSLs:

    • Screen existing NSL collections for lines containing the chloroplast genome of O. nivara

    • Verify the presence of O. nivara ycf4 variants through sequencing

  • Phenotypic Characterization:

    • Compare photosynthetic parameters (quantum yield, electron transport rate, NPQ)

    • Assess growth and development under various light regimes and stress conditions

    • Quantify PSI assembly efficiency and stability

  • Molecular Analysis:

    • Examine Ycf4 protein accumulation and stability

    • Characterize the composition of PSI complexes

    • Investigate potential epistatic interactions with nuclear genes

  • Environmental Response Testing:

    • Subject NSLs to various environmental stressors (light intensity, temperature, drought)

    • Monitor stress response markers and recovery kinetics

    • Assess photosynthetic resilience under fluctuating conditions

This approach leverages the genetic resources developed through backcrossing O. nivara with cultivated rice (Koshihikari) to produce BC1F1 through BC5F1 generations, allowing isolation of specific genomic contributions .

What are the main technical challenges in expressing and purifying functional recombinant O. nivara Ycf4?

Researchers face several significant challenges when working with recombinant Ycf4:

  • Membrane Protein Expression Difficulties:

    • Ycf4 is a thylakoid membrane protein, making heterologous expression challenging

    • Potential toxicity to host cells when overexpressed

    • Proper membrane insertion and folding may require specialized expression systems

  • Maintaining Native Conformation:

    • Detergent selection critically impacts protein stability and functionality

    • Loss of lipid environment may alter protein conformation

    • Purification conditions must balance solubilization with maintenance of structure

  • Complex Formation:

    • Native Ycf4 functions within a large complex (>1500 kD)

    • Recombinant systems may lack essential interaction partners

    • Assembly factors specific to O. nivara may be absent in heterologous systems

  • Functional Validation:

    • Lack of standardized assays for Ycf4 activity

    • Difficulty in reconstituting PSI assembly in vitro

    • Challenges in distinguishing direct from indirect effects on PSI accumulation

Methodological Solutions:

  • Use of specialized expression vectors designed for membrane proteins

  • Co-expression with known interaction partners

  • Incorporation of native lipids during purification

  • Development of cell-free expression systems with thylakoid membrane supplements

How might CRISPR/Cas9 technology be applied to study O. nivara Ycf4 function?

CRISPR/Cas9 technology offers powerful approaches for studying chloroplast-encoded genes like ycf4, though with some unique considerations for plastid genome editing:

  • Chloroplast Genome Targeting Strategies:

    • Deliver Cas9 with chloroplast localization signals

    • Design plastid-optimized CRISPR systems

    • Use biolistic transformation methods for chloroplast targeting

  • Experimental Applications:

    • Generate precise point mutations to study structure-function relationships

    • Create knockout lines to assess essentiality in different genetic backgrounds

    • Introduce tagged versions for in vivo localization and interaction studies

    • Replace O. sativa ycf4 with O. nivara variants to study functional differences

  • Homoplasmy Achievement:

    • Implement selection strategies to achieve homoplasmic transformants

    • Use high antibiotic pressure to drive segregation of transformed chloroplast genomes

    • Verify homoplasmy through PCR, Southern blotting, and sequencing methods similar to those used in tobacco YCF4 studies

  • Phenotypic Analysis Framework:

    • Monitor photosynthetic parameters (Fv/Fm, PSI/PSII ratio)

    • Assess growth under various light intensities and spectral compositions

    • Quantify PSI subunit accumulation and assembly rates

    • Measure stress tolerance and recovery capabilities

This technology could overcome traditional limitations in chloroplast genome engineering, allowing unprecedented precision in studying Ycf4 function in its native context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.