Recombinant Oryza nivara Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQPV
Uniprot No.

Target Background

Function
CP47 is a core component of photosystem II (PSII) that binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from water, generating oxygen and a proton gradient that subsequently drives ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what role does its protein product play in photosynthesis?

The psbB gene encodes the CP47 protein, which serves as one of the integral antenna proteins in Photosystem II. CP47 functions as a core component that binds chlorophyll molecules and participates in light harvesting and energy transfer to the reaction center of PSII. Structurally, the CP47 protein contains multiple histidine residues in hydrophobic regions that are involved in chlorophyll binding. These histidines appear in five pairs spaced by 13 or 14 amino acids and are located in hydrophobic regions of the protein .

When studying the psbB gene, researchers have found that interspecies comparison reveals significant conservation. For example, the DNA sequence of psbB from the cyanobacterium Synechocystis 6803 shows 68% homology with that of spinach, while the predicted amino acid sequence demonstrates even higher conservation at 76% homology . This higher conservation at the protein level reflects the functional importance of the CP47 structure across diverse photosynthetic organisms.

Experimental interruption of the psbB gene demonstrates its essential nature - insertion of a kanamycin resistance gene fragment into psbB results in complete loss of Photosystem II activity . This confirms that an intact CP47 is absolutely required for a functional PSII complex, although it doesn't necessarily indicate that this protein houses the reaction center itself.

What experimental techniques are most effective for isolating and characterizing CP47 protein complexes?

Isolation and characterization of CP47-containing complexes requires a strategic combination of techniques:

Protein purification approaches:

  • Affinity chromatography using histidine-tagged CP47 (commonly His6-tagged) followed by fast protein liquid chromatography (FPLC) with a nickel-affinity column

  • Further purification via glycerol gradient ultracentrifugation to separate distinct His-CP47–containing complexes

  • Storage in specialized buffer conditions (typically containing 25% glycerol, MgCl₂, CaCl₂, and MES buffer at pH 6.0)

Analytical techniques:

  • High-resolution clear native acrylamide gel electrophoresis to resolve intact protein complexes

  • SDS-PAGE for denaturing protein separation and molecular weight determination

  • 77-K absorption spectroscopy to characterize chlorophyll spectral properties

  • Tandem mass spectrometry following in-gel or in-solution digestion for protein identification and quantification

  • Immunoblotting with specific antisera to confirm the presence of target proteins

These methods can effectively separate CP47 in various complex states, from its association with complete PSII complexes to subcomplexes like the recently discovered "no reaction center" complex (NRC), which contains CP47 and CP43 but lacks the reaction center proteins D1, D2, PsbE, PsbF, and PsbI .

How is CP47 integrated into the thylakoid membrane during protein synthesis?

The integration of CP47 into the thylakoid membrane involves a sophisticated co-translational process with specific auxiliary factors:

The ribosome-bound protein Pam68 plays a crucial role in CP47 membrane integration. This protein specifically stabilizes membrane segments of CP47 and facilitates the insertion of chlorophyll molecules into the translated CP47 polypeptide chain . Biochemical analysis using purification of Flag-tagged Pam68 from Synechocystis PCC 6803 has revealed a large protein complex containing ribosomes, SecY translocase, and the CP47 protein .

The timing of this process is precisely coordinated - Pam68 associates with CP47 at an early phase of its biogenesis and remains involved until the attachment of the small PSII subunit PsbH . This suggests a sequential assembly process where auxiliary factors are recruited at specific stages of membrane protein synthesis.

The importance of this insertion mechanism is highlighted by deletion studies showing that elimination of both Pam68 and PsbH nearly abolishes CP47 synthesis. Intriguingly, this defect can be rescued by enhancing chlorophyll biosynthesis , indicating a complex coordination between protein synthesis, membrane insertion, and pigment incorporation.

What are the chlorophyll binding properties of CP47 and how do they influence excitation energy transfer in Photosystem II?

CP47 binds 16 chlorophyll molecules that play critical roles in light harvesting and energy transfer to the PSII reaction center . Advanced quantum mechanical studies have revealed important properties of these chlorophyll binding sites:

Excitation energy profile:
Recent quantum mechanics/molecular mechanics (QM/MM) studies utilizing time-dependent density functional theory have computed the excitation energies of all CP47 chlorophylls in membrane-embedded cyanobacterial PSII. This research has quantified the critical electrostatic effects of the protein environment on chlorophyll site energies .

Energy transfer pathways:
The ranking of site energies and identity of the most red-shifted chlorophylls (B3, followed by B1) differs from previous hypotheses in the literature . These red-shifted chlorophylls are particularly important as they likely represent the lowest energy states that funnel excitation energy toward the reaction center.

Structural determinants:
The histidine residues identified in CP47 are prime candidates for chlorophyll coordination. Their specific spacing (13-14 amino acids apart) and location in hydrophobic regions create the appropriate environment for chlorophyll binding . This structural arrangement optimizes the geometric orientation for efficient excitation energy transfer.

To experimentally study these properties, researchers employ:

  • Site-directed mutagenesis of putative chlorophyll-coordinating histidines

  • Ultrafast spectroscopic techniques to measure energy transfer kinetics

  • Low-temperature (77K) absorption and fluorescence spectroscopy

  • Computational modeling to predict energy transfer pathways

What is the "no reaction center" complex (NRC) and how does it challenge current models of PSII repair?

The recently discovered "no reaction center" complex (NRC) represents a significant revision to our understanding of Photosystem II repair mechanisms:

NRC composition and structure:
NRC is a stable pigment-protein complex containing the PSII core antenna proteins CP47 and CP43, along with most of their associated low molecular mass subunits and the assembly factor Psb27. Critically, it lacks five key PSII reaction center polypeptides: D1, D2, PsbE, PsbF, and PsbI .

Evidence for NRC integrity:
Analytical ultracentrifugation and clear native PAGE analysis confirm that NRC is a stable complex and not simply a mixture of free CP47 and CP43 proteins . Immunoblotting, mass spectrometry, and ultrafast spectroscopic results support the absence of a functional reaction center in this complex .

Relationship to photodamage:
NRC appears in higher abundance in cells exposed to high light and impaired protein synthesis. Additionally, genetic deletion of PsbO on the PSII luminal side results in increased NRC population, indicating that NRC forms in response to photodamage as part of the PSII repair process .

Implications for repair models:
This finding challenges current models of the PSII repair cycle by implying an alternative repair strategy. Formation of this complex may maximize repair economy by preserving intact PSII core antennas in a single complex available for reassembly, minimizing the risk of randomly diluting multiple recycling components in the thylakoid membrane following photodamage .

This discovery suggests that rather than complete disassembly and degradation of PSII components during repair, cells maintain certain subcomplexes as modular building blocks, enabling more efficient reassembly once new reaction center proteins are synthesized.

How might recombinant expression systems be designed to produce functional Oryza nivara CP47?

Developing an effective expression system for recombinant Oryza nivara CP47 requires addressing several complex challenges:

Co-translational chlorophyll incorporation:
Research on CP47 biogenesis indicates that chlorophyll insertion occurs during translation with assistance from auxiliary proteins like Pam68 . An effective expression system would need to either include these factors or provide functional alternatives.

Membrane integration requirements:
As a multi-spanning membrane protein, CP47 requires specialized translocation machinery like the SecY translocase, which has been found in complexes with CP47 during synthesis . Expression hosts should maintain compatible membrane insertion pathways.

Chlorophyll availability coordination:
Deletion studies show that CP47 synthesis can be restored in Pam68/PsbH mutants by enhancing chlorophyll biosynthesis , suggesting that expression systems must coordinate chlorophyll availability with protein production.

Proposed methodological approach:

  • Select photosynthetic expression hosts (e.g., cyanobacteria or green algae) with compatible chlorophyll biosynthesis pathways

  • Co-express key auxiliary proteins like Pam68 identified in natural systems

  • Consider fusion constructs with stabilizing partners if full-length expression is problematic

  • Implement inducible expression systems synchronized with chlorophyll production

  • Include appropriate purification tags positioned to avoid interference with membrane insertion

When designing experiments, researchers should verify protein folding and function through spectroscopic analysis of chlorophyll binding and energy transfer capabilities, rather than merely confirming protein accumulation.

What genetic approaches can be used to study CP47 function in Oryza nivara photosynthesis?

Studying CP47 function in Oryza nivara requires sophisticated genetic strategies that consider its essential nature and complex assembly:

QTL analysis approaches:
Studies of Oryza nivara introgression lines have identified numerous QTLs affecting plant performance traits like plant height, panicle characteristics, and branching patterns . While not directly focused on psbB, similar approaches could identify photosynthesis-related QTLs potentially associated with psbB variation.

Targeted genetic modification strategies:

  • CRISPR/Cas9-mediated gene editing for precise psbB modification

  • Development of RNAi or antisense constructs for partial CP47 suppression

  • Creation of transgenic complementation lines expressing modified CP47 versions

  • Generation of promoter-reporter fusions to study psbB expression patterns

Experimental design considerations:
When phenotyping transgenic or mutant plants, researchers should implement comprehensive photosynthetic analyses including:

  • Chlorophyll fluorescence measurements (ΦPSII, NPQ, Fv/Fm)

  • Gas exchange parameters (CO₂ assimilation, transpiration)

  • Biochemical quantification of PSII complex assembly

  • Growth and yield measurements under varying light conditions

The complex relationship between photosynthetic efficiency and agronomic traits requires detailed analysis of how CP47 modifications affect plant performance. For instance, tracking how alterations in energy transfer efficiency within CP47 translate to changes in quantum yield, and ultimately to biomass production and yield components like those examined in QTL studies of Oryza nivara .

How can computational approaches enhance our understanding of CP47 structure-function relationships?

Computational methods offer powerful tools for investigating CP47 structure-function relationships:

Quantum mechanical approaches:
Multiscale quantum mechanics/molecular mechanics (QM/MM) with time-dependent density functional theory enables precise calculation of chlorophyll excitation energies within the protein environment . These calculations provide insights into energy transfer pathways that would be difficult to resolve experimentally.

Table 1: Computational Methods for CP47 Analysis

MethodApplicationKey Insights
QM/MMChlorophyll excitation energiesIdentification of red-shifted chlorophylls (B3, B1)
Molecular dynamicsStructural stabilityAssessment of which protein regions maintain native conformation
Homology modelingCross-species comparisonPrediction of structural conservation between cyanobacterial and plant CP47
Electrostatic calculationsProtein-pigment interactionsQuantification of electrostatic effects on chlorophyll properties

Integration with experimental data:
The most robust approach combines computational predictions with experimental validation:

  • Use computational models to identify critical residues controlling chlorophyll properties

  • Generate targeted mutations of these residues

  • Measure spectroscopic and functional outcomes

  • Refine computational models based on experimental results

These computational approaches are particularly valuable when studying subtle modifications in CP47 that might affect energy transfer efficiency without disrupting protein assembly, potentially explaining how natural variation in psbB might contribute to photosynthetic advantages observed in some Oryza nivara genotypes.

What is the relationship between CP47 and auxiliary proteins during PSII assembly and repair?

The interaction between CP47 and auxiliary proteins is essential for proper PSII assembly and repair:

Pam68-CP47 interaction:
Pam68 associates with CP47 during early biogenesis and remains involved until PsbH attachment . This interaction appears to serve multiple functions:

  • Stabilizing membrane segments during insertion

  • Facilitating chlorophyll incorporation

  • Coordinating the sequential assembly process

Complex formation dynamics:
Purification studies have identified a large complex containing ribosomes, SecY translocase, and CP47, suggesting co-translational assembly . Importantly, Pam68 binds to ribosomes even in the absence of CP47 translation, indicating it may "pre-assemble" with the translational machinery in preparation for CP47 synthesis .

Functional dependencies:
The critical nature of these interactions is demonstrated by deletion studies showing that elimination of both Pam68 and PsbH nearly abolishes CP47 synthesis . The finding that this defect can be rescued by enhancing chlorophyll biosynthesis reveals complex coordination between protein synthesis and cofactor availability .

Repair cycle involvement:
The discovery of the NRC complex containing CP47, CP43, and the assembly factor Psb27 suggests that auxiliary proteins remain involved during repair processes, potentially helping maintain these subcomplexes in a state ready for reassembly with newly synthesized reaction center components.

This sophisticated network of protein-protein interactions ensures proper folding, cofactor incorporation, and assembly of CP47 into functional PSII complexes, and maintains efficient recycling during the damage-repair cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.