Recombinant Oryza nivara Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Function of PsbD (D2 Protein) in Photosystem II

The D1 and D2 proteins form the core of the PSII reaction center and are structurally related . PSII, a light-driven water:plastoquinone oxidoreductase, uses light energy to extract electrons from H₂O, which generates O₂ and a proton gradient .

Importance of D2 Protein in PSII Assembly and Biogenesis

D2 protein synthesis is important for PSII accumulation in vascular plants . The abundance of psbD mRNA is critical in controlling D2 synthesis, but D2 is not the rate-limiting subunit for PSII accumulation in tobacco .

Synechocystis PCC6803 wild type and in mutant strains lacking genes psbA, psbB, psbC, psbDIC/DII, or the psbEFLJ operon were analyzed by two-dimensional Blue-native/SDS-PAGE for accumulation of monomer and dimer photosystem (PS) II reaction center core complexes . Mutant cells assembled PSII precomplexes only, as revealed by in vivo pulse-chase radiolabeling experiments . In DeltapsbC and DeltapsbB, assembly of reaction center cores lacking CP43 and reaction center complexes was detected, respectively . In DeltapsbA, protein subunits CP43, CP47, D2, and cytochrome b559 were synthesized, but proteins did not assemble .

D-de Loop of D2 Protein

The D1 and D2 proteins contain several loop regions, including an extended stroma-exposed loop between transmembrane helix D and parallel helix de (the D-de loop), which is phylogenetically conserved in both proteins . A study was conducted in Synechocystis sp. PCC 6803, where the stroma-exposed loop of D1 replaced that of D2, creating a chimeric D2 protein . A single-base deletion in one of the transgenic lines shifted the reading frame of the chimeric gene, resulting in loss of D2 accumulation and photosystem II assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Oryza nivara (Indian wild rice)
Target Names
psbD
Target Protein Sequence
MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor, and subsequent electron acceptors. D2 is crucial for assembling a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of D2 protein (psbD) in Photosystem II?

D2 protein (psbD) forms the reaction core of Photosystem II (PSII) as a heterodimer with the D1 protein (PsbA). With a molecular mass of approximately 39.5 kDa, psbD is homologous to the D1 protein but slightly larger. The accumulation of D2 protein represents a critical step in the assembly of the PSII reaction center complex . Functionally, the D2 protein not only contributes to the stabilization of the PSII complex in the membrane but may also play a specific regulatory role for the D1 protein, affecting it at either translational or post-translational levels . In experimental systems using mutants, when D2 is absent, other core PSII proteins are synthesized and inserted into the membrane fraction but fail to accumulate, indicating D2's crucial role in complex stability .

How does the amino acid sequence of Oryza nivara psbD compare to other species?

The full-length Oryza nivara (Indian wild rice) psbD protein consists of 353 amino acids. The sequence (MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL) shows remarkable conservation across species . Comparative analysis indicates that psbD is highly conserved among photosynthetic organisms, with global antibodies recognizing this protein across diverse species including Arabidopsis thaliana, Anabaena 7120, Chlamydomonas reinhardtii, and multiple other plant and algal species . This high degree of conservation reflects the essential function of this protein in photosynthesis across evolutionary divides.

What are the optimal conditions for recombinant expression of Oryza nivara psbD in E. coli?

For successful recombinant expression of Oryza nivara psbD in E. coli, researchers should employ a system that includes an N-terminal His tag for purification purposes. Expression should be conducted under controlled temperature conditions, typically at lower temperatures (16-20°C) after induction to reduce the formation of inclusion bodies, which is common with membrane proteins . The protein's hydrophobic nature necessitates the addition of mild detergents during extraction and purification. For optimal yield, expression vectors containing strong promoters like T7 are recommended, with IPTG induction at OD600 of 0.6-0.8. Post-extraction, the protein requires proper refolding protocols due to its complex structure, potentially involving gradual detergent dilution methods. The final recombinant protein yield should exceed 90% purity as determined by SDS-PAGE before experimental use .

How should recombinant psbD protein be stored to maintain stability and function?

Recombinant psbD protein requires careful storage protocols to maintain stability and function. The purified protein is typically provided as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . After reconstitution, it is recommended to add glycerol to a final concentration between 5-50% (with 50% being standard in many preparations) and aliquot for long-term storage at -20°C/-80°C to prevent protein degradation . Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability. For short-term use, working aliquots can be stored at 4°C for up to one week . The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein integrity . Prior to any experimental use, vials should be briefly centrifuged to ensure all content is collected at the bottom.

What experimental approaches can detect interactions between D2 (psbD) and D1 proteins in the PSII complex?

Multiple complementary techniques are necessary to thoroughly characterize D2-D1 interactions in the PSII complex. Co-immunoprecipitation using specific antibodies against psbD (such as the polyclonal rabbit antibody AS06 146) can pull down the D2-D1 heterodimer, confirming their physical interaction . Crosslinking experiments with various crosslinkers of different lengths can map the proximity of specific residues between the two proteins. Förster Resonance Energy Transfer (FRET) analysis using fluorescently labeled antibodies or fusion proteins can measure the distance between D1 and D2 in intact complexes. For in-depth structural characterization, researchers can employ cryo-electron microscopy or X-ray crystallography, though these require highly purified and stable complexes. Additionally, yeast two-hybrid or split-GFP systems with membrane adaptations can identify specific interacting domains. Biophysical approaches such as Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) can determine binding constants and thermodynamic parameters of these interactions.

How can researchers differentiate between direct effects of psbD mutation and secondary effects on PSII assembly?

Differentiating between direct and secondary effects of psbD mutations requires a systematic experimental approach. A comprehensive strategy begins with pulse-chase experiments to track the synthesis, assembly, and degradation rates of PSII components in both wild-type and mutant systems . Researchers should conduct quantitative RT-PCR and Northern blot analyses to assess whether changes in other PSII proteins result from altered transcription. Immunoprecipitation of assembly intermediates at various time points after pulse labeling can reveal which steps in the assembly pathway are directly impacted. Complementation experiments involving the expression of wild-type psbD in mutant backgrounds can confirm whether observed phenotypes are directly attributable to psbD deficiency . Additionally, site-directed mutagenesis targeting specific domains of psbD can help pinpoint which regions are critical for various functions. Native gel electrophoresis coupled with Western blotting can determine which PSII subcomplexes are forming or failing to form in mutant strains. Research has shown that in psbD mutants, although other core PSII proteins are synthesized and inserted into membranes, they fail to accumulate, suggesting D2's crucial role in complex stability rather than just protein expression .

What are the consequences of frame-shift mutations in the psbD gene for PSII function?

Frame-shift mutations in the psbD gene have profound consequences for PSII function. A comprehensive study of a Chlamydomonas reinhardtii mutant revealed that a 46 bp direct DNA duplication in the coding region of the psbD gene caused a frame-shift mutation, resulting in a truncated transcript coding for only 186 amino acid residues instead of the normal 352 . This truncated D2 peptide was never detected even after pulse-labeling, indicating extreme instability of the mutant protein . Most importantly, this mutation led to a non-photosynthetic phenotype due to complete loss of PSII function .

The consequences extend beyond the D2 protein itself to affect the entire PSII complex. Despite the presence of normal levels of mRNA for the D1 protein, little or no D1 protein was detected in this mutant, suggesting that D2 plays a critical role in regulating D1 at either the translational or post-translational level . All other core PSII proteins were synthesized and inserted into the membrane fraction but never accumulated to normal levels . This demonstrates that frame-shift mutations in psbD create cascading effects throughout the PSII complex, disrupting not only the synthesis and stability of the D2 protein but also the assembly and stability of the entire PSII reaction center.

How does the amino acid composition of specific domains in psbD affect electron transport efficiency?

The amino acid composition of specific domains in psbD directly influences electron transport efficiency in PSII through several critical mechanisms. The protein contains transmembrane helices with precisely positioned amino acids that coordinate cofactors essential for electron transfer. Particular attention should be given to the regions involved in binding the non-heme iron, pheophytin, and the QB plastoquinone binding pocket, as these directly participate in the electron transport chain .

Changes in the hydrophobic residues of the transmembrane domains can alter protein folding and stability, indirectly affecting electron transport by disrupting optimal positioning of electron carriers. The protein's stromal and lumenal loops contain charged and polar residues that create the electrostatic environment necessary for efficient electron movement. Specific D2 residues form hydrogen bonds with D1, ensuring proper orientation for electron transfer from pheophytin to QB .

Research has demonstrated that even conservative mutations in these critical regions can cause substantial changes in redox potentials and electron transfer rates. For experimental analysis of these effects, site-directed mutagenesis targeting specific amino acids followed by measurements of oxygen evolution, chlorophyll fluorescence kinetics, and thermoluminescence would provide direct correlation between amino acid composition and electron transport efficiency.

How can antibodies against psbD be optimized for use in various photosynthetic organisms?

Optimizing antibodies against psbD for use across diverse photosynthetic organisms requires strategic experimental design. Researchers should begin with epitope selection from highly conserved regions of psbD. The global antibody approach, as exemplified by the AS06 146 polyclonal rabbit antibody, targets epitopes conserved across multiple species including Arabidopsis thaliana, Anabaena 7120, Chlamydomonas reinhardtii, and numerous other photosynthetic organisms . For novel organisms not previously tested, preliminary Western blots with varying protein concentrations (5-20 μg chlorophyll/lane) should be conducted to determine optimal detection conditions .

Sample preparation must account for organism-specific cell wall properties, with appropriate mechanical or enzymatic disruption methods tailored to each species. Blocking conditions require optimization, typically with 5% blotto or BSA, but may need adjustment for different organisms to reduce background . Antibody titration experiments (1:1000 to 1:10,000 dilutions) should be performed for each new species. For organisms with low PSII content, sensitivity can be enhanced through chemiluminescent detection systems or by concentrating thylakoid membranes before analysis . Researchers should be aware of potential cross-reactions, such as the confirmed cross-reaction with TLA1 protein in Chlamydomonas reinhardtii, and design appropriate controls accordingly .

What are the most reliable methods for quantifying psbD protein levels in thylakoid membranes?

Quantification of psbD protein levels in thylakoid membranes requires robust methodological approaches to ensure accuracy and reproducibility. The gold standard involves quantitative Western blotting using purified recombinant psbD standards for calibration. Researchers should create a standard curve using known quantities (0.1-10 ng) of recombinant Oryza nivara psbD protein alongside experimental samples . For precisely controlled quantification, immunoblotting with specific antibodies such as the polyclonal rabbit antibody AS06 146 is recommended, with detection via fluorescent secondary antibodies rather than chemiluminescence for wider linear range and greater precision .

How should researchers interpret data variability in psbD protein detection across different photosynthetic organisms?

When confronted with variability in psbD protein detection across different photosynthetic organisms, researchers should employ a systematic interpretational framework. First, analyze whether the variability reflects biological reality or methodological artifacts. For biological variations, consider taxonomy-related structural differences in the D2 protein, as even highly conserved proteins may present species-specific epitopes that affect antibody recognition . Growth conditions significantly impact PSII content, with organisms in stationary phase often showing dramatically reduced PSII levels that can lead to detection problems independent of antibody quality .

For methodological considerations, establish whether extraction protocols are optimized for each organism's unique cell wall composition and membrane properties. Sample preparation should be standardized for protein-to-chlorophyll ratios rather than total protein, as these ratios can vary significantly between species. Statistical analysis of data variability should employ tools like Mean Square Successive Difference (MSSD) to distinguish random fluctuations from meaningful biological patterns . The MSSD metric accounts for both variability and temporal dependency over time, making it particularly valuable for time-course experiments .

To minimize misinterpretation, researchers should include appropriate internal controls and reference standards with known quantities of recombinant psbD . When comparing data across studies, attention must be paid to the specific antibodies used, as different epitopes may yield different detection patterns across species.

What are the potential sources of aberrant data in psbD mutation studies and how can they be mitigated?

Aberrant data in psbD mutation studies can arise from multiple sources that require specific mitigation strategies. First, incomplete segregation of mutations in organellar genomes can create mixed populations of wild-type and mutant proteins, particularly in chloroplast transformation experiments. Researchers should verify homoplasmy through multiple generations and with different molecular techniques (PCR, Southern blotting) . Second, compensatory mutations may arise spontaneously, masking the original mutation's effects; whole genome sequencing can identify such secondary mutations .

Phenotypic analyses can be confounded by environmental variables like light intensity, temperature fluctuations, and media composition. Standardizing these conditions across experiments and including appropriate wild-type controls grown simultaneously is essential. Technical variations in protein extraction efficiency from different samples can be minimized by using internal loading controls and normalizing to multiple reference proteins.

To mitigate these issues, researchers should: (1) employ multiple technical and biological replicates, (2) use standardized protocols with quality control checkpoints, (3) implement statistical approaches that account for data variability, (4) verify key findings with complementary techniques, and (5) include appropriate positive and negative controls in all experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.