Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryza sativa ATP Synthase Subunit a (atpI)

Protein Identity:

  • Gene Name: atpI (also annotated as Os10g0527100 or Nip041 in rice) .

  • UniProt ID: P0C2Y5 (Oryza sativa subsp. japonica) .

  • Function: Integral component of the chloroplast ATP synthase CF₀ complex, facilitating proton translocation across thylakoid membranes to drive ATP synthesis .

Expression Systems:

Host SystemPurityFormApplications
E. coli≥85%LyophilizedStructural studies, enzyme assays
Yeast≥85%Liquid/LyophilizedProtein interaction studies
Baculovirus≥85%LiquidLarge-scale production
Mammalian Cells≥85%LiquidFunctional assays

Role in ATP Synthase Assembly

  • Interaction Partners: AtpI forms the CF₀ subcomplex with AtpH (subunit IV), creating the proton channel .

  • Assembly Factors:

    • Atp11: A dual-localized chaperone in mitochondria and chloroplasts interacts with the β subunit of ATP synthase, aiding CF₁ assembly .

    • BFA3: Facilitates CF₁ assembly by stabilizing subunit interactions .

Overexpression and Photosynthetic Efficiency

  • AtpD Overexpression: Increasing AtpD (a CF₁ subunit) in rice enhances ATP synthase abundance and thylakoid proton conductivity, leading to higher CO₂ assimilation rates under high light .

  • Biotechnological Impact: Modulating atpI expression could improve crop photosynthetic efficiency and yield .

Immunoassays and Protein Studies

  • ELISA Kits: Commercial recombinant atpI is used to develop quantitative assays for ATP synthase studies .

  • Antibody Production: Serves as an antigen for generating antibodies targeting chloroplast ATP synthase .

Key Research Insights

StudyMethodFinding
Atp11 interaction (Arabidopsis)Yeast two-hybridAtp11 binds CF₁β, aiding CF₁ assembly in chloroplasts .
MTHI1 regulation (Chlamydomonas)Mutant analysisMTHI1 OPR protein stabilizes atpI mRNA and enhances translation .
AtpD overexpression (Rice)BN-PAGE, gas exchangeHigher ATP synthase activity increases photosynthetic CO₂ assimilation .

Challenges and Future Directions

  • Assembly Mechanisms: The precise role of atpI in CF₀-CF₁ coupling remains unclear .

  • Biotechnological Optimization: Engineering atpI stability or interaction partners could enhance ATP synthase efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
atpI; PA041; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Oryza sativa (Rice)
Target Names
atpI
Target Protein Sequence
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
ATP synthase subunit a is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of atpI in the chloroplastic ATP synthase complex?

The atpI protein (also known as CF₀ subunit a) is an essential component of the membrane-embedded CF₀ portion of the chloroplastic ATP synthase complex. It forms part of the proton channel alongside the CF₀ subunit II (also known as subunit b in some literature). The complete chloroplast ATP synthase has a CF₁CF₀ structure with a stoichiometry of α₃β₃γ₁ε₁δ₁I₁II₁III₁₄IV₁ .

AtpI functions as part of the selective proton channel that allows protons to flow through the thylakoid membrane, using the proton motive force generated by photosynthetic electron transport to drive ATP synthesis . This conversion of the electrochemical gradient into ATP is fundamental to energy production in chloroplasts.

How is the expression of atpI regulated in chloroplasts?

In green algae like Chlamydomonas reinhardtii, the expression of atpI is controlled posttranscriptionally by gene-specific trans-acting protein factors. One key regulator is the octotricopeptide repeat protein MTHI1, which enhances the translation of atpI mRNA .

MTHI1 targets the 5′ untranslated regions of both atpH and atpI, suggesting a coordinated regulation mechanism for these two components of the proton channel . This co-regulation parallels what has been observed in yeast mitochondria, where the expression of Atp6p (the mitochondrial equivalent of AtpI) is linked to the expression of Atp9p (equivalent to AtpH) .

What expression systems are recommended for recombinant production of Oryza sativa atpI?

For recombinant expression of chloroplastic proteins like atpI, several expression systems can be considered:

When expressing atpI, it's important to consider its membrane-embedded nature and potential toxic effects when overexpressed.

What methods can be used to study the assembly of atpI into the ATP synthase complex?

Studying ATP synthase assembly requires specialized approaches:

  • In vivo labeling analysis: This technique has been used to demonstrate that assembly factors like BFA3 are required for efficient assembly of the CF₁ component of chloroplast ATP synthase .

  • Co-immunoprecipitation studies: These can identify interaction partners of atpI during assembly. Similar approaches have shown that Atp11-HA specifically interacts with CF₁β but not CF₁α or CF₁γ in chloroplast stroma .

  • Yeast two-hybrid analysis: This can be used to map protein-protein interactions during assembly. For example, this technique demonstrated that Atp11 specifically interacts with CF₁β among the five CF₁ subunits (CF₁α to CF₁ε) and two CF₀ subunits (CF₀I and CF₀II) .

  • Blue native PAGE: This technique can separate intact complexes and assembly intermediates, allowing visualization of assembly progression and identification of subcomplexes.

How can researchers investigate the interaction between atpI and other ATP synthase subunits?

To investigate interactions between atpI and other ATP synthase subunits:

  • Yeast two-hybrid screening: Despite its limitations for membrane proteins, modified Y2H systems can be used with appropriate controls. This approach has successfully demonstrated interactions between assembly factors and specific ATP synthase subunits .

  • Affinity chromatography: Using tagged versions of atpI to pull down interaction partners. For example, affinity chromatography using Atp11-HA plants confirmed the specific interaction of Atp11 and CF₁β in chloroplast stroma in vivo .

  • Cross-linking coupled with mass spectrometry: This approach can identify transient or weak interactions by creating covalent bonds between interacting proteins prior to analysis.

  • Split-fluorescent protein complementation: This method can visualize protein interactions in living cells by reconstituting fluorescence when two protein fragments come together due to interaction of their fusion partners.

What mutagenesis approaches are most effective for studying atpI function?

Several mutagenesis strategies can be employed to study atpI function:

  • Site-directed mutagenesis: This allows precise modification of specific amino acids to study structure-function relationships. Key residues involved in proton translocation or subunit interaction can be targeted.

  • Domain swapping: Replacing domains of atpI with equivalent regions from different species can help identify species-specific functional elements.

  • Deletion analysis: Systematic removal of portions of the protein can identify essential regions for assembly or function.

  • Custom-designed RNA-binding proteins: Recently, RNA-binding pentatricopeptide repeat (PPR) proteins have been designed to specifically bind and induce cleavage of target mRNAs in mitochondria, such as ATP synthase subunit 1 (atp1) . Similar approaches could potentially be adapted for chloroplast atpI studies.

What role do assembly factors play in atpI incorporation into the ATP synthase complex?

The assembly of chloroplast ATP synthase involves several specialized factors:

  • BFA3 (Biogenesis Factor Required for ATP Synthase 3): In Arabidopsis, BFA3 is required for CF₁ assembly. In the bfa3 mutant, chloroplast ATP synthase subunit levels were reduced to approximately 25% of wild-type levels .

  • Atp11 and Atp12: While Atp11 is present in both chloroplasts and mitochondria, Atp12 is exclusively localized in mitochondria in Arabidopsis. Atp11 specifically interacts with the β subunit of both chloroplast ATP synthase and mitochondrial ATP synthase . The loss of either Atp11 or Atp12 is lethal in Arabidopsis, highlighting their essential roles .

  • BFA1 and PAB: These are additional assembly factors that interact with CF₁β and CF₁γ subunits, respectively. Interestingly, while both Atp11 and BFA3/BFA1 interact with CF₁β, they bind to different sites, suggesting distinct mechanisms of action .

The finding that overexpression of Atp11 in bfa3 mutants could not complement the phenotype supports the hypothesis that these assembly factors operate through different mechanisms .

How can researchers differentiate between the roles of atpI in chloroplasts versus related subunits in mitochondria?

Differentiating between chloroplastic and mitochondrial ATP synthase components requires careful experimental design:

  • Subcellular localization studies: Using fluorescent protein fusions to visualize localization. For example, Atp11-GFP was shown to co-localize with both chloroplasts and mito-tracker red, while Atp12-GFP exclusively overlapped with mito-tracker red .

  • Organelle isolation: Purification of intact chloroplasts and mitochondria followed by immunoblot analysis can confirm the presence of proteins in specific compartments. This approach confirmed that Atp11 is present in both chloroplast stroma and mitochondria .

  • Specific antibodies: Developing antibodies that recognize only the chloroplastic atpI (and not mitochondrial homologs) enables specific detection in mixed samples.

  • Genetic complementation studies: Testing whether chloroplastic atpI can complement defects in mitochondrial ATP synthase assembly and vice versa can reveal functional similarities and differences.

What techniques are available for monitoring the assembly process of ATP synthase complexes containing atpI?

Several techniques can be used to monitor ATP synthase assembly:

  • Pulse-chase experiments: These can track the incorporation of newly synthesized atpI into larger complexes over time.

  • Sucrose gradient centrifugation: This technique separates complexes based on size and can identify assembly intermediates.

  • Cryo-electron microscopy: This can provide structural information about assembly intermediates and the final complex.

  • In vivo labeling analysis: This approach has shown that assembly of the CF₁ component is less efficient in assembly factor mutants like bfa3 compared to wild type .

  • Immunoprecipitation with stage-specific antibodies: Antibodies recognizing specific assembly intermediates can be used to track the assembly process.

How does atpI structure and function differ between Oryza sativa and other plant species?

Comparative analysis of ATP synthase components reveals both conserved and variable features:

  • Sequence conservation: Alignment of atpI sequences across species can identify highly conserved regions likely critical for function versus variable regions that may confer species-specific properties.

  • Structural variations: While the core function of atpI in proton translocation is conserved, species-specific adaptations may exist to optimize ATP synthase function under different environmental conditions.

  • Expression regulation: The regulation of atpI expression shows both similarities and differences across species. In Chlamydomonas, the OPR protein MTHI1 controls the expression of both atpH and atpI, targeting their 5′ UTRs . Similar regulatory systems may exist in rice with species-specific variations.

  • Assembly pathways: The assembly factors for ATP synthase show evolutionary conservation. For example, Atp11 and Atp12 in Arabidopsis fulfill similar functions as their orthologs in yeast during assembly of F-type ATP synthase .

What bioinformatic tools are most useful for analyzing atpI structure and predicting functional domains?

Several bioinformatic approaches are valuable for atpI analysis:

  • Multiple sequence alignment tools (ClustalW, MUSCLE, T-Coffee): These identify conserved regions across species that likely have functional importance.

  • Protein structure prediction (AlphaFold, I-TASSER): These can generate 3D models of atpI to visualize transmembrane domains and functional regions.

  • Transmembrane domain prediction (TMHMM, Phobius): These specialized tools identify membrane-spanning regions of atpI.

  • Protein-protein interaction prediction (STRING, PSICQUIC): These databases can suggest potential interaction partners based on experimental data and computational predictions.

  • Gene co-expression analysis: Tools that analyze transcriptomic data can identify genes with expression patterns similar to atpI, suggesting functional relationships.

  • Whole-genome analysis approaches: These have been used to identify the complete TCS gene families in Oryza sativa, providing insights into gene structures, conserved motifs, chromosome locations, and phylogeny .

What are the major challenges in purifying functional recombinant atpI and how can they be overcome?

Purification of membrane proteins like atpI presents several challenges:

  • Solubility issues:

    • Challenge: As a membrane protein, atpI has hydrophobic domains that make it difficult to maintain in solution.

    • Solution: Use of specialized detergents (DDM, LMNG) or amphipols for extraction and stabilization. Consider fusion with solubility-enhancing tags (MBP, SUMO).

  • Proper folding:

    • Challenge: Ensuring correct folding in heterologous expression systems.

    • Solution: Expression at lower temperatures (16-20°C), co-expression with chaperones, or use of self-assembly systems.

  • Functional verification:

    • Challenge: Confirming that purified atpI retains its native conformation and activity.

    • Solution: Reconstitution into liposomes or nanodiscs followed by proton transport assays or ATP synthesis measurements.

  • Low yield:

    • Challenge: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Codon optimization for the expression host, use of strong inducible promoters, and optimization of induction conditions.

How can researchers effectively measure the activity of recombinant atpI in isolation and as part of the ATP synthase complex?

Activity measurement approaches include:

  • Proton transport assays: Using pH-sensitive fluorescent dyes to monitor proton movement through reconstituted atpI or ATP synthase complexes.

  • ATP synthesis/hydrolysis assays: Measuring the production of ATP when atpI is incorporated into complete ATP synthase complexes in liposomes with an established proton gradient.

  • Patch-clamp electrophysiology: For direct measurement of proton conductance through atpI or ATP synthase complexes incorporated into planar lipid bilayers.

  • Thermal stability assays: These can indirectly assess proper folding and complex formation by monitoring the protein's melting temperature.

  • Hydrogen/deuterium exchange mass spectrometry: This technique can provide information about structural dynamics and conformational changes in response to different conditions.

What quality control methods should be employed when working with recombinant atpI?

Quality control for recombinant atpI should include:

  • Purity assessment: SDS-PAGE and western blotting to confirm identity and purity of the recombinant protein.

  • Mass spectrometry: To verify the exact mass and potential post-translational modifications.

  • Circular dichroism spectroscopy: To assess secondary structure content and proper folding.

  • Size-exclusion chromatography: To evaluate aggregation state and complex formation.

  • Functional assays: As described above, to confirm biological activity.

  • Stability testing: Monitoring protein stability under various storage conditions to establish optimal handling protocols.

  • Lipid composition analysis: For reconstituted systems, verifying that the lipid environment properly mimics the native thylakoid membrane.

What emerging technologies show promise for advancing research on chloroplastic ATP synthase subunits?

Several cutting-edge approaches hold potential for ATP synthase research:

  • Cryo-electron microscopy: Advancing resolution to atomic level for membrane protein complexes like ATP synthase enables detailed structural analysis.

  • Designer RNA-binding proteins: Custom-designed RNA-binding pentatricopeptide repeat (PPR) proteins can specifically target and manipulate expression of genes like atpI . This approach has been demonstrated for mitochondrial atp1 and could be adapted for chloroplast genes.

  • Optogenetic tools: These could allow precise temporal control of ATP synthase assembly or function through light-activated protein interactions.

  • Nanobody technology: The development of nanobodies (single-domain antibodies) specific to different conformational states of ATP synthase could provide new tools for structural and functional studies.

  • Single-molecule techniques: Methods such as single-molecule FRET could provide insights into the dynamics of ATP synthase assembly and function at unprecedented resolution.

How might research on atpI contribute to improving photosynthetic efficiency in crops?

Research on atpI has several potential applications for crop improvement:

What strategies can resolve expression difficulties with recombinant atpI?

When facing expression challenges:

  • Low expression levels:

    • Try different expression hosts (E. coli strains BL21(DE3), C41/C43, or eukaryotic systems)

    • Optimize codon usage for the host organism

    • Test different promoters and induction conditions

    • Consider fusion partners that enhance expression (MBP, SUMO, Trx)

  • Toxicity issues:

    • Use tightly controlled inducible promoters

    • Reduce induction temperature (16-20°C)

    • Lower inducer concentration

    • Consider cell-free expression systems

  • Protein degradation:

    • Add protease inhibitors during extraction

    • Co-express with chaperones

    • Test different extraction buffers with various stabilizing agents

  • Inclusion body formation:

    • Optimize solubilization conditions using different detergents

    • Consider refolding protocols if necessary

    • Test expression at lower temperatures with slower induction

How can researchers troubleshoot assembly defects in ATP synthase complexes?

When investigating assembly defects:

  • Identify the stage of assembly blockage:

    • Use native PAGE and immunoblotting to detect accumulation of specific subcomplexes

    • Analyze the stability of individual subunits in the absence of proper assembly

  • Examine assembly factor functionality:

    • Verify expression and localization of known assembly factors like Atp11 and BFA3

    • Test for proper interaction between assembly factors and their target subunits

  • Assess post-translational modifications:

    • Check for proper processing of transit peptides

    • Investigate potential regulatory modifications that might affect assembly

  • Verify membrane insertion:

    • For membrane components like atpI, confirm proper insertion into the membrane

    • Analyze membrane composition for factors that might affect complex assembly

  • Optimize experimental conditions:

    • Test different buffer compositions and pH conditions

    • Adjust salt concentration and temperature during assembly steps

The literature shows that assembly factors are critical - loss of either Atp11 or Atp12 is lethal in Arabidopsis, and the bfa3 mutant shows reduced ATP synthase levels to approximately 25% of wild-type .

What controls should be included in experiments investigating atpI function and interactions?

Rigorous experimental design requires appropriate controls:

  • Positive controls:

    • Include known interaction partners (e.g., other CF₀ subunits) in interaction studies

    • Use wild-type atpI alongside mutant variants for functional comparisons

    • Include fully assembled ATP synthase complexes as standards for assembly studies

  • Negative controls:

    • Test unrelated membrane proteins in binding assays to confirm specificity

    • Use empty vectors in expression studies

    • Include non-targeted regions in mutagenesis experiments

  • Technical controls:

    • Perform parallel experiments with mitochondrial ATP synthase components to distinguish organelle-specific effects

    • Include samples from different time points to track assembly progression

    • Use multiple detection methods to verify results (e.g., both co-IP and Y2H for interaction studies)

  • Validation approaches:

    • Confirm in vitro results with in vivo experiments

    • Use complementary techniques to verify findings (e.g., verify Y2H results with co-IP as demonstrated in the studies of Atp11 interactions )

    • Perform rescue experiments with wild-type protein to confirm specificity of mutant phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.