Recombinant Oryza sativa Chloroplast envelope membrane protein (cemA)
Shipped with Ice Packs 
In Stock 
Description
Functional Role in Chloroplast Carbon Transport
cemA is indirectly involved in enhancing inorganic carbon (Ci: CO₂ + HCO₃⁻) uptake into chloroplasts. Key findings include:
Mechanism of Action
-
CO₂/HCO₃⁻ Uptake: Disruption of cemA in Chlamydomonas reinhardtii reduces the affinity of Ci transport systems for their substrates, impairing photosynthetic efficiency under high light .
-
Proton Extrusion: Homologous proteins in cyanobacteria (e.g., cotA) are linked to proton extrusion, suggesting a conserved role in maintaining pH gradients for Ci transport .
Experimental Evidence
Recombinant Production
-
Expression System: Expressed in E. coli with an N-terminal His tag for purification via nickel affinity chromatography .
-
Purification: Lyophilized protein is reconstituted in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .
Experimental Uses
cemA Homologs
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion during development.
If you require a specific tag, please inform us, and we will prioritize its inclusion during development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Oryza sativa (Rice)
Target Names
cemA
Target Protein Sequence
MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSQTLLTAIQEKRVLERF
MELEDLFILDEMIKEKPNTHVQNPPIGIRKEIIQLAKIDNEGHLHIILHFSTNIICLAIL
SGSFFLGKEELVILNSWVQEFFYNLNDSVKAFFILLVTDFFVGFHSTRGWELLIRWVYND
LGWVPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.
Target Background
Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
