Recombinant Oryza sativa Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa Cytochrome b6-f Complex Subunit 4 (petD)

The Recombinant Oryza sativa Cytochrome b6-f complex subunit 4 (petD) is a recombinant protein derived from rice (Oryza sativa), which is part of the cytochrome b6-f complex. This complex plays a crucial role in photosynthesis by facilitating electron transfer between photosystem II (PSII) and photosystem I (PSI), as well as participating in cyclic electron flow around PSI . The petD subunit, also known as the 17 kDa polypeptide, is essential for the assembly and stability of the cytochrome b6-f complex .

Function and Importance

The cytochrome b6-f complex is a multisubunit complex embedded in the thylakoid membrane of chloroplasts. It is pivotal in both linear and cyclic electron transport processes during photosynthesis. In linear electron transport, it receives electrons from PSII and transfers them to PSI, contributing to the generation of a proton gradient necessary for ATP synthesis . The cyclic electron flow around PSI helps maintain the balance of ATP and NADPH production, which is crucial for photoprotection and efficient photosynthesis .

Assembly and Stability

The assembly of the cytochrome b6-f complex involves several subunits, including PetD. PetD forms a mildly protease-resistant subcomplex with cytochrome b6 and cytochrome f, which serves as a template for further assembly . The interaction between PetD and other subunits, such as cytochrome b6, is critical for the stability and proper functioning of the complex. Mutations affecting these interactions can lead to instability and degradation of the complex .

Research Findings

Recent studies have highlighted the importance of interactions between the cytochrome b6-f complex and other photosynthetic components. For example, NdhS, a subunit of the NADPH dehydrogenase-like complex, interacts with the cytochrome b6-f complex in Arabidopsis, facilitating cyclic electron transport . Additionally, the cytochrome b6 subunit's C-terminus plays a role in state transitions by influencing the phosphorylation of the STT7 protein kinase .

Recombinant Production

Recombinant production of the Oryza sativa Cytochrome b6-f complex subunit 4 (petD) involves expressing the petD gene in a suitable host system. This approach allows for the large-scale production of the protein for research and potential biotechnological applications. Suppliers like CUSABIO TECHNOLOGY LLC offer recombinant petD proteins, which can be used in various biochemical assays and structural studies .

Table: Comparison of PetD Across Different Organisms

OrganismPetD FunctionComplex Role
Arabidopsis thalianaEssential for complex stabilityPart of cytochrome b6-f complex
Synechocystis sp.Involved in electron transportPart of cytochrome b6-f complex
Oryza sativaElectron transport in photosynthesisPart of cytochrome b6-f complex

References Agrisera. (2023). Anti-PetD | Cytochrome b6-f complex subunit 4. Huang et al. (1994); Breyton et al. (1997); Mosser et al. (1997); Baniulis et al. (2009). The stromal side of the cytochrome b6f complex regulates state transitions. (2024). ChemicalBook. Recombinant Oryza sativa Cytochrome b6-f complex subunit 4 (petD). UniProt. petB - Cytochrome b6 - Oryza sativa (Rice). Functional insensitivity of the cytochrome b6f complex to structure perturbation. (2003). NdhS interacts with cytochrome b6f to form a complex in Arabidopsis. (2023).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; PA099; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Oryza sativa (Rice)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does subunit 4 (petD) play in Oryza sativa?

The Cytochrome b6-f complex is a crucial membrane protein complex in the thylakoid membrane of chloroplasts that facilitates electron transfer between Photosystem II and Photosystem I during photosynthesis. In Oryza sativa (rice), subunit 4 (petD) is an essential structural component that contributes significantly to the complex's stability and function in the electron transport chain.

This protein belongs to the broader cytochrome family in rice, which includes other well-studied members such as OsCYP96B4 (Oryza sativa Cytochrome P450 96B4). Research has shown that disruption of cytochrome genes in rice can lead to significant phenotypic changes, including defects in cell elongation and plant development . The petD subunit specifically contributes to maintaining the structural integrity of the b6-f complex, which is essential for proper electron flow during photosynthesis.

How do mutations in cytochrome genes affect Oryza sativa development?

Mutations in cytochrome genes can significantly impact rice development and morphology. For example, a study of the oscyp96b4 mutant demonstrated that disruption of this cytochrome gene by transposon insertion resulted in a semi-dwarf phenotype characterized by defects in cell elongation and pollen germination . This mutation affected plant height in a transcript dosage-dependent manner, with the mutant exhibiting defects in lipid metabolism that appear to regulate cell elongation .

When applying these findings to research on the petD gene, researchers should consider that mutations might similarly affect photosynthetic efficiency, plant development, and potentially yield. The severity of the phenotype would depend on whether the mutation leads to complete loss of function or partial impairment of the protein's activity.

What expression systems are most effective for producing recombinant Oryza sativa cytochrome proteins?

Several expression systems can be used for producing recombinant Oryza sativa cytochrome proteins, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesBest For
Oryza sativa (homologous)Native post-translational modificationsLower yieldFunctional studies requiring authentic modifications
Yeast (P. pastoris, S. cerevisiae)Higher yield, eukaryotic foldingDifferent glycosylation patternsStructural studies, large-scale production
Schizosaccharomyces pombeGood for membrane proteinsVariable expressionFunctional characterization
E. coliHigh yield, simple protocolLack of post-translational modificationsBasic structural studies

Research has shown that the choice of expression system can significantly impact protein properties. For instance, recombinant human serum albumin produced in Oryza sativa (OsrHSA) showed considerably different glycation patterns and thermal stability compared to the same protein expressed in Pichia pastoris . When working with cytochrome proteins like petD, these expression-dependent modifications can affect protein folding, stability, and function.

What genetic modification techniques are most effective for studying petD function in Oryza sativa?

Several genetic modification approaches have proven effective for studying gene function in Oryza sativa, which can be applied to petD research:

  • Transposon-based mutagenesis: The insertion of transposable elements (such as Ds) can disrupt gene function, as demonstrated in studies of OsCYP96B4 . This approach allows for subsequent reversion experiments by remobilizing the transposon.

  • RNA interference (RNAi): Studies have shown that transgenic plants harboring gene-specific double-stranded RNA interference constructs can effectively mimic mutant phenotypes in rice . For petD, this approach would allow for targeted reduction in gene expression.

  • Complementation analysis: After creating a mutant, introducing the wild-type gene should restore normal function. This technique has successfully confirmed the phenotype-genotype relationship in rice cytochrome mutants .

  • Reversion experiments: For transposon-based mutations, remobilizing the transposon element (e.g., using Ac transposase) can restore gene function if no reading frame shifts occur, providing additional confirmation of gene function .

When designing experiments using these techniques, it's critical to include appropriate controls and perform detailed molecular characterization to confirm the intended genetic modifications.

What analytical methods should be used to characterize recombinant Oryza sativa Cytochrome b6-f complex subunit 4?

A comprehensive characterization of recombinant petD protein requires multiple analytical approaches:

  • Structural characterization:

    • Far UV circular dichroism spectropolarimetry (far UV CD) for secondary structure analysis

    • Fluorescence spectroscopy for tertiary structure assessment

    • Size exclusion chromatography (SEC) to detect aggregation and oligomeric states

  • Purity and homogeneity assessment:

    • Reversed-phase high-performance liquid chromatography (RP-HPLC)

    • Capillary electrophoresis (CE)

    • SDS-PAGE for molecular weight verification

  • Post-translational modification analysis:

    • Liquid chromatography-mass spectrometry (LC-MS) to identify modifications such as glycation

    • Site-specific analysis of modification patterns

  • Functional characterization:

    • Electron transfer activity assays

    • Thermal stability assessments

    • Ligand binding studies

Research has shown that recombinant proteins expressed in Oryza sativa can exhibit significant post-translational modifications that affect their structure and function . Therefore, thorough characterization is essential to understand the properties of the recombinant petD protein.

How can researchers optimize embryo rescue techniques for creating interspecific hybrids involving Oryza sativa?

When working with genetically modified rice or creating interspecific hybrids, embryo rescue techniques are often essential. Based on successful protocols for creating diploid and tetraploid interspecific hybrids between Oryza sativa and wild rice species, researchers should implement a comprehensive technical system comprising:

  • Hormone treatment: Apply appropriate plant growth regulators to enhance embryo development.

  • Repeated pollination: Multiple pollination events can increase the chance of successful fertilization.

  • Hybrid embryo rescue: Carefully excise and culture embryos on specialized media before they abort.

  • Chromosome doubling: For tetraploid development, apply agents like colchicine at optimized concentrations .

This integrated approach has proven successful in creating hybrids between Oryza sativa and other species such as Oryza barthii . When applying these techniques to work with cytochrome mutants, researchers should optimize each step based on the specific rice varieties being used and the particular genetic modifications involved.

How do post-translational modifications affect the structure and function of recombinant Oryza sativa cytochrome proteins?

Post-translational modifications (PTMs) significantly impact recombinant proteins expressed in Oryza sativa. Research comparing recombinant human serum albumin produced in rice (OsrHSA) versus yeast expression systems revealed:

  • Increased glycation: LC-MS analysis identified a greater number of hexose-glycated arginine and lysine residues on OsrHSA compared to the same protein expressed in yeast .

  • Structural alterations: Tertiary structural changes were observed in most OsrHSA samples, which correlated well with the degree of arginine/lysine glycation .

  • Aggregation tendency: Both the number of glycated residues and the degree of glycation correlated positively with the quantity of non-monomeric species .

  • Stability effects: OsrHSA showed considerably higher thermal stability than the same protein expressed in Pichia pastoris, potentially due to stabilizing effects of modifications .

When studying recombinant petD, researchers should carefully evaluate PTMs and their impact on protein function. Modifications specific to the rice expression system may significantly alter the protein's properties compared to the native form, affecting experimental results and interpretations.

What strategies can address lot-to-lot and supplier-to-supplier variability in recombinant Oryza sativa proteins?

Significant variability has been observed in recombinant proteins produced in Oryza sativa systems. Studies of OsrHSA revealed both supplier-to-supplier variability and, more critically, lot-to-lot variability in products from the same manufacturer . To address these challenges:

  • Implement comprehensive characterization:

    • Use multiple analytical techniques (SEC, RP-HPLC, CE, LC-MS)

    • Perform structural analyses (CD, fluorescence spectroscopy)

    • Quantify specific modifications at the molecular level

  • Establish reference standards:

    • Develop well-characterized reference materials

    • Create standardized quality control protocols

  • Implement statistical process control:

    • Monitor critical quality attributes across production batches

    • Establish acceptance criteria based on validated ranges

  • Optimize expression and purification:

    • Standardize growth conditions and expression parameters

    • Develop consistent purification protocols with validated yields

These approaches can help minimize variability and ensure consistent protein quality for research applications involving recombinant petD and other Oryza sativa proteins.

How can heterologous expression in model organisms advance our understanding of petD function?

Heterologous expression of Oryza sativa cytochrome genes in model organisms can provide valuable insights into protein function. For example, the expression of OsCYP96B4 in Schizosaccharomyces pombe resulted in missegregation and wider cells, suggesting effects on cell division and morphology .

For petD research, heterologous expression strategies could include:

  • Yeast models:

    • Expression in S. cerevisiae or S. pombe to study protein localization

    • Analysis of growth phenotypes under various conditions

    • Interaction studies with other components of electron transport systems

  • Arabidopsis models:

    • Complementation of Arabidopsis petD mutants with the rice ortholog

    • Creation of chimeric proteins to identify functional domains

    • Analysis of photosynthetic parameters in transgenic plants

  • Bacterial systems:

    • Expression of functional domains for structural studies

    • Reconstitution experiments with other complex components

    • Mutational analysis to identify critical residues

When interpreting results from heterologous expression, researchers should consider how the different cellular environment might affect protein folding, stability, and interactions compared to the native context in rice chloroplasts.

What statistical approaches are most appropriate for analyzing experimental data from petD studies?

When analyzing data from petD studies, researchers should employ rigorous statistical methods tailored to the experimental design:

  • For phenotypic analyses of mutants:

    • ANOVA or t-tests for comparing growth parameters between wild-type and mutant plants

    • Regression analysis for dose-dependent effects, similar to the transcript dosage-dependent effects observed with OsCYP96B4

    • Chi-square analysis for segregation studies when examining genetic inheritance

  • For protein characterization:

    • Principal component analysis (PCA) to identify patterns in multivariate data sets

    • Correlation analyses to examine relationships between modifications and functional parameters

    • Paired statistical tests when comparing the same protein from different expression systems

  • For functional studies:

    • Repeated measures ANOVA for time-course experiments

    • Non-linear regression for enzyme kinetics

    • Bootstrapping or permutation tests for complex data sets with non-normal distributions

Statistical significance should be set at p < 0.05, with appropriate corrections for multiple comparisons when necessary. Sample sizes should be determined through power analysis to ensure adequate statistical power while minimizing experimental resources.

How should researchers interpret contradictory findings between in vitro and in vivo studies of cytochrome proteins?

Contradictions between in vitro and in vivo studies of cytochrome proteins are not uncommon and require careful interpretation:

  • Consider expression system effects:

    • Research has shown that proteins expressed in different systems exhibit different modifications and properties

    • Post-translational modifications present in vivo may be absent in in vitro systems

  • Evaluate protein context:

    • Cytochrome proteins typically function within membrane complexes

    • Isolated proteins may behave differently than those in their native membrane environment

  • Assess experimental conditions:

    • pH, ionic strength, and presence of cofactors can significantly impact protein function

    • In vitro conditions rarely perfectly mimic the chloroplast environment

  • Examine protein quality:

    • Aggregation or misfolding may occur during purification

    • Lot-to-lot variability has been documented in recombinant proteins

When faced with contradictory findings, researchers should systematically investigate potential sources of discrepancy rather than immediately discounting either result. Combining multiple approaches (biochemical, genetic, structural) can help resolve contradictions and provide a more complete understanding of protein function.

What criteria should be used to evaluate the quality and reliability of recombinant Oryza sativa proteins for research applications?

Based on comprehensive studies of recombinant proteins expressed in Oryza sativa, researchers should evaluate quality and reliability using the following criteria:

  • Purity assessment:

    • Multiple chromatographic techniques should show consistent profiles

    • Mass spectrometry should confirm the expected molecular weight

    • Contaminants should be below established thresholds

  • Structural integrity:

    • Secondary structure (by CD spectroscopy) should match theoretical predictions

    • Tertiary structure (by fluorescence spectroscopy) should be consistent with functional protein

    • Aggregation profile by SEC should show predominantly monomeric species

  • Modification characterization:

    • LC-MS should identify and quantify post-translational modifications

    • Modification patterns should be consistent across batches

    • The impact of modifications on function should be established

  • Functional activity:

    • Enzymatic or binding activities should reach minimum thresholds

    • Activity should be stable under defined storage conditions

    • Batch-to-batch variation should be within established limits

  • Reproducibility:

    • Multiple lots should show consistent characteristics

    • Independent preparations should yield similar results

    • Supplier-to-supplier variability should be understood and accounted for

By establishing clear criteria for protein quality, researchers can ensure that experimental results are reliable and reproducible, advancing our understanding of Oryza sativa cytochrome proteins like petD.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.