Recombinant Oryza sativa Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Expression

  • Primary Sequence: Comprises 215 amino acids (1–215aa) with a molecular weight of ~24 kDa .

  • Expression System: Produced in Escherichia coli with an N-terminal His tag for purification .

  • Post-Translational Features: Contains transmembrane helices critical for integration into thylakoid membranes .

ParameterDetails
UniProt IDP0C315 (Oryza sativa)
Gene NamepetB (chloroplast genome)
Tag TypeHis tag (determined during production)
Storage Conditions-20°C in Tris-based buffer with 50% glycerol

Role in the Cytochrome b₆f Complex

  • Electron Transport: Facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) and cyclic electron flow .

  • Complex Assembly: PetB interacts with Rieske FeS (PetC) and cytochrome f (PetA) to stabilize the dimeric structure of the b₆f complex .

  • Proton Gradient Formation: Contributes to ATP synthesis by participating in the Q-cycle mechanism .

Regulatory Interactions

  • Stability Mechanisms: PetB levels are post-transcriptionally regulated by RNA-binding proteins (e.g., PrfB3) under light and stress conditions .

  • Synergistic Effects: Overexpression of Rieske FeS (PetC) in Arabidopsis increases PetB abundance, enhancing electron transport and biomass .

Experimental Use Cases

  • Biochemical Studies: Recombinant PetB aids in structural analyses of the b₆f complex using techniques like Blue Native PAGE and Western blot .

  • Transgenic Research: Used to study overexpression effects on photosynthetic efficiency and crop yield .

Key Findings

  • Yield Enhancement: Overexpression of petB orthologs in model plants correlates with increased ATP synthase activity and biomass .

  • Stress Adaptation: PetB stability is modulated under environmental stress, influencing chloroplast function .

Recombinant Expression Workflow

  1. Cloning: petB gene inserted into E. coli vectors with compatible promoters .

  2. Induction: Optimized using IPTG and low-temperature (16°C) conditions to enhance soluble protein yield .

  3. Purification: Affinity chromatography via His tag, achieving ≥85% purity (SDS-PAGE verified) .

Stability Considerations

  • Storage: Lyophilized protein stable at -80°C for years; reconstituted aliquots usable for one week at 4°C .

  • Activity Loss: Repeated freeze-thaw cycles degrade functionality .

Future Directions

  • Crop Engineering: Leveraging PetB overexpression to enhance photosynthetic efficiency in rice .

  • Structural Biology: Cryo-EM studies to resolve PetB’s role in b₆f complex dimerization .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Oryza sativa (Rice)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the structure-function relationship of Cytochrome b6 compare between rice and model plant species?

While the core structure and function of Cytochrome b6 are highly conserved across plant species, studies reveal species-specific differences in complex assembly and regulation. Research on the Arabidopsis dac mutant demonstrated severe defects in cytochrome b6/f complex accumulation, providing insight into conservation patterns .

Key comparative aspects include:

FeatureOryza sativaArabidopsis thalianaSignificance
Protein length215 amino acidsSimilar lengthHigh conservation reflects critical function
Complex assemblyForms dimers and monomersSimilar architecture with quantifiable dimer/monomer ratioAssembly mechanisms can be studied via BN-PAGE analysis
StabilityRelatively stable when assembledAssembled subunits show stability comparable to riceEnables comparative functional studies
Mutant phenotypesLess characterizeddac mutant shows defective accumulationArabidopsis mutants provide insights applicable to rice research

Researchers should note that while functional domains are conserved, regulatory mechanisms and protein-protein interactions may exhibit species-specific variations .

What expression systems yield functional recombinant Oryza sativa Cytochrome b6?

Several expression systems have been employed for producing recombinant Cytochrome b6, each with distinct advantages:

For optimal expression, researchers should consider:

  • Codon optimization for the selected expression system

  • Inclusion of appropriate targeting sequences if using eukaryotic hosts

  • Temperature and induction conditions that promote proper folding

What purification strategies maintain the structural integrity of recombinant Cytochrome b6?

Purification of membrane proteins like Cytochrome b6 presents unique challenges. A methodical approach includes:

  • Membrane isolation: For rice-expressed Cytochrome b6, thylakoid membrane isolation is a critical first step, typically performed through differential centrifugation protocols .

  • Solubilization: Gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended to maintain the protein's native conformation while extracting it from the membrane.

  • Chromatographic separation:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Ion exchange chromatography based on the protein's isoelectric point

    • Size exclusion chromatography for final polishing and buffer exchange

For rice endosperm-expressed recombinant proteins, one-step purification protocols have achieved recoveries of approximately 74% with 80% purity, which could potentially be adapted for Cytochrome b6 .

How can the assembly of recombinant Cytochrome b6 into functional complexes be assessed?

The functional assembly of Cytochrome b6 into the complete cytochrome b6/f complex can be analyzed using several complementary techniques:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates protein complexes in their native state, allowing visualization of monomers, dimers, and assembly intermediates. The research on the Arabidopsis dac mutant demonstrated that BN-PAGE can effectively detect changes in the ratio between monomers and dimers of the cytochrome b6/f complex .

  • Immunoprecipitation of newly synthesized proteins: Pulse-labeling with radioactive amino acids followed by immunoprecipitation using antibodies against Cytochrome b6 can reveal the rate of protein synthesis and assembly into complexes .

  • Spectroscopic analysis: Absorption spectroscopy can verify the proper incorporation of heme cofactors, essential for electron transfer function.

  • Electron microscopy: Negative staining or cryo-EM can provide structural validation of properly assembled complexes.

For quantitative assessment of complex formation, researchers should compare the relative abundance of monomers, dimers, and assembly intermediates under different experimental conditions .

What methods effectively measure the electron transport activity of recombinant Cytochrome b6?

Functional characterization of Cytochrome b6 electron transport activity requires specialized biophysical techniques:

  • Oxygen evolution/consumption measurements: Using Clark-type electrodes to measure changes in oxygen concentration during electron transport.

  • Artificial electron donors and acceptors: Employing compounds like duroquinol as donors and ferricyanide as acceptors to isolate specific segments of the electron transport chain.

  • Spectrophotometric assays: Monitoring absorbance changes at specific wavelengths (e.g., cytochrome c reduction at 550 nm) to track electron flow through the cytochrome b6/f complex.

  • Chlorophyll fluorescence measurements: Assessing parameters like quantum yield of PSII and non-photochemical quenching to indirectly evaluate cytochrome b6/f function in intact systems.

  • Flash-induced redox kinetics: Using short light flashes to initiate electron transfer, followed by spectroscopic monitoring of the redox states of electron carriers.

When validating recombinant protein function, researchers should compare activity with native protein preparations and include appropriate controls for non-specific activities.

How can site-directed mutagenesis of recombinant Cytochrome b6 advance understanding of photosynthetic electron transport?

Site-directed mutagenesis of recombinant Cytochrome b6 offers powerful insights into structure-function relationships within the photosynthetic electron transport chain:

  • Heme coordination sites: Mutations in amino acids that coordinate heme groups (identified from the sequence provided in search result ) can reveal the specific contribution of each cofactor to electron transfer.

  • Transmembrane domains: Systematic alterations to membrane-spanning regions can illuminate how protein-lipid interactions influence complex stability and function.

  • Subunit interaction interfaces: Mutations at interaction surfaces between Cytochrome b6 and other complex components (such as PetD) can define critical residues for assembly and stability .

  • Regulatory sites: Identifying amino acids subject to post-translational modifications that regulate complex activity under different physiological conditions.

The expression system should be chosen based on the specific goals of the mutagenesis study. For instance, rice endosperm expression may be particularly valuable for mutations expected to impact interactions with plant-specific factors .

What insights can comparative studies between wild-type and recombinant Cytochrome b6 provide about protein turnover?

Comparative studies between wild-type and recombinant Cytochrome b6 can reveal critical aspects of protein dynamics and regulation:

  • Protein stability analysis: Research on the Arabidopsis dac mutant demonstrated how lincomycin (a chloroplast protein synthesis inhibitor) treatment can be used to assess protein turnover rates. Similar approaches can be applied to compare wild-type and recombinant Cytochrome b6 stability .

  • Pulse-chase experiments: Studies have shown that newly synthesized cytochrome b6/f subunits have shorter half-lives in mutant backgrounds. Similar methodologies can evaluate if recombinant proteins exhibit altered turnover kinetics .

  • Quantitative proteomic analysis: Mass spectrometry-based approaches can provide absolute quantification of protein degradation rates.

A comprehensive experimental design should include:

  • Multiple timepoints after inhibition of protein synthesis

  • Immunoblotting to track protein levels

  • Controls like D1 protein (known to have rapid turnover) and CF1β (relatively stable)

  • Analysis of both assembled complexes and unassembled subunits

What are common challenges in heterologous expression of Cytochrome b6 and how can they be addressed?

Heterologous expression of membrane proteins like Cytochrome b6 presents several challenges that researchers should anticipate:

  • Protein misfolding and aggregation:

    • Challenge: Improper folding in heterologous systems, especially bacterial hosts

    • Solution: Lower induction temperatures (16-20°C), specialized E. coli strains (C41/C43), or eukaryotic expression systems like rice endosperm

  • Cofactor incorporation:

    • Challenge: Incomplete incorporation of heme groups essential for function

    • Solution: Supplementation with δ-aminolevulinic acid to boost heme synthesis, co-expression of heme biosynthesis enzymes

  • Toxicity to host cells:

    • Challenge: Overexpression of membrane proteins can disrupt host cell membranes

    • Solution: Tightly regulated expression systems, use of plant-based platforms with appropriate compartmentalization

  • Low yields:

    • Challenge: Insufficient protein production for downstream applications

    • Solution: Optimization of codon usage, testing multiple fusion tags, breeding transformed rice lines to homozygosity to increase yield

For rice endosperm expression specifically, researchers have reported that yields typically increase from the T1 to T3 generations as lines are bred to homozygosity, with some recombinant proteins showing improvements from 37 μg/g to 46 μg/g dry seed weight .

How can researchers validate the authenticity and functionality of purified recombinant Cytochrome b6?

Comprehensive validation of recombinant Cytochrome b6 requires multiple analytical approaches:

  • Structural verification:

    • Western blotting with antibodies specific to Cytochrome b6

    • Mass spectrometry to confirm amino acid sequence

    • Circular dichroism spectroscopy to assess secondary structure elements

  • Functional assays:

    • Spectroscopic analysis of heme incorporation

    • Electron transfer activity measurements

    • Complex formation assessment via BN-PAGE

  • Comparative analyses:

    • Side-by-side comparison with native protein

    • Assessment of protein stability using techniques demonstrated in the dac mutant studies

    • Evaluation of complex assembly patterns

  • Controls and standards:

    • Include positive controls (native protein when available)

    • Negative controls (inactive mutants or denatured protein)

    • Calibration standards for quantitative assays

Documentation of these validation steps is essential for ensuring reproducibility and reliability of subsequent experiments using the recombinant protein.

How does Cytochrome b6 research connect with broader genomic studies in Oryza sativa?

Cytochrome b6 research integrates with genome-scale studies of rice in several important ways:

  • Two-component signaling systems: Genome analysis of Oryza sativa has revealed the presence of 51 genes encoding 73 putative TCS proteins involved in histidine-aspartate phosphorelay signaling, which may regulate photosynthetic processes including those involving the cytochrome b6/f complex .

  • Evolutionary conservation: Comparative genomic analyses between Oryza sativa and Arabidopsis thaliana provide insights into the conservation of photosynthetic machinery across different plant lineages .

  • Transcript expression patterns: Analysis of available Massively Parallel Signature Sequencing (MPSS) data can reveal expression patterns of petB and related genes across different tissues and developmental stages .

  • Insertional mutagenesis resources: The Tos17 database provides information on potential insertional mutants affecting cytochrome b6 function or regulation .

Researchers should consider these broader genomic contexts when designing experiments with recombinant Cytochrome b6, as they may reveal unexpected regulatory mechanisms or interaction partners.

What emerging technologies are advancing functional studies of recombinant photosynthetic proteins?

Several cutting-edge technologies are enhancing functional studies of recombinant photosynthetic proteins like Cytochrome b6:

  • CRISPR/Cas9 genome editing: Enables precise modification of the native petB gene in rice to study specific domains or regulatory elements in their natural genomic context.

  • Single-molecule techniques: Fluorescence resonance energy transfer (FRET) and atomic force microscopy (AFM) allow visualization of dynamic protein interactions and conformational changes during electron transport.

  • Cryo-electron microscopy: Recent advances in resolution enable detailed structural analysis of membrane protein complexes like cytochrome b6/f without crystallization.

  • Organ-on-a-chip approaches: These technologies represent human disease models and could be adapted to study plant photosynthetic processes in controlled microenvironments, potentially reducing reliance on animal testing in related agricultural research .

  • BioRNA technologies: Recombinant or bioengineered RNA agents can be used to investigate post-transcriptional regulation of genes involved in photosynthesis, including those encoding components of the cytochrome b6/f complex .

These emerging approaches complement traditional biochemical methods and can provide unprecedented insights into the function and regulation of Cytochrome b6 in rice.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.