Recombinant Oryza sativa Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Ycf4 is a 22-kD thylakoid membrane protein with two transmembrane domains, conserved across photosynthetic organisms from cyanobacteria to higher plants . In Chlamydomonas reinhardtii, it is essential for PSI assembly, acting as a scaffold for intermediate complexes containing PSI subunits (e.g., PsaA, PsaB, PsaC, PsaD, PsaE, PsaF) and the retinal-binding protein COP2 . In higher plants like tobacco, Ycf4 is non-essential but enhances PSI stability and efficiency .

The recombinant Oryza sativa Ycf4 is a partial protein produced in yeast, often used to study its interactions with PSI subunits and other chloroplast proteins .

Functional Interactions

Ycf4 facilitates PSI assembly by stabilizing intermediate complexes. Key interactions include:

  • PSI subunits: Strong binding to psaB, psaC, and psaH via hydrogen bonds (bond lengths: 2.62–2.93 Å) .

  • ATP synthase: Interacts with the β-subunit (atpB) of ATP synthase, forming 12 hydrogen bonds .

  • RuBisCO: Binds to the large subunit (rbcL) and light-harvesting complexes (LHC) .

Production Method

The recombinant Oryza sativa Ycf4 is expressed in yeast and purified via affinity chromatography. Key details include:

PropertyValueSource
Purity>85% (SDS-PAGE)
Expression HostYeast
Tag TypeDetermined during production
Storage Conditions-20°C/-80°C (lyophilized or in solution with glycerol)

Purification Challenges

  • Yeast expression: Requires optimization to ensure proper folding and solubility.

  • Thylakoid membrane integration: Recombinant Ycf4 must retain membrane-binding ability for functional studies .

Role in PSI Biogenesis

  • Chaperone function: Stabilizes intermediate complexes during PSI assembly, particularly in young chloroplasts .

  • Non-essentiality in higher plants: Δycf4 tobacco mutants show reduced PSI levels but retain photosynthetic activity, indicating compensatory mechanisms .

Evolutionary Insights

  • Rapid evolution: In legumes like Lathyrus and Pisum, ycf4 undergoes positive selection, with lineage-specific pseudogenization or loss .

  • Alternative pathways: Species lacking ycf4 (e.g., Lathyrus) likely rely on other assembly factors for PSI biogenesis .

Key Studies

  1. Tobacco Δycf4 mutants

    • Phenotype: Pale yellow leaves, reduced PSI accumulation, and impaired photosynthetic performance .

    • Transcriptome analysis: No change in PSI gene expression, but decreased rbcL, LHC, and atpB transcripts .

  2. Electron microscopy of Ycf4 complexes

    • Structure: Purified Ycf4 complexes from Chlamydomonas measure 285 × 185 Å, suggesting oligomeric states .

  3. In silico docking studies

    • C-terminal dominance: Strong interactions with psaC, psaH, and atpB via hydrogen bonds .

Table 1: Key Properties of Recombinant Oryza sativa Ycf4

ParameterDetail
Uniprot IDP0C514 (partial)
Protein LengthPartial (1–185 amino acids)
TagNot specified
Purity>85% (SDS-PAGE)
Storage BufferTris-based, 50% glycerol

Table 2: Ycf4’s Role in Different Organisms

OrganismYcf4 FunctionEssentiality
ChlamydomonasCritical for PSI assemblyEssential
Nicotiana tabacumAuxiliary factor for PSI stabilityNon-essential
Lathyrus (legumes)Pseudogenized or lostNon-essential

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Specify your required tag type for preferential development.
Synonyms
ycf4; PA069; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Oryza sativa (Rice)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWIELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGKNIISVLPSQQILFF PQGVVMSFYGIAGLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRF LMRDIQSIRIQVKEGLFPRRILYMEIRGQGAIPLTRTDEKFFTPREIEQKAAELAYFLRI PMEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Ycf4 in photosynthetic organisms?

Ycf4 (hypothetical chloroplast reading frame no. 4) is a 22-kD thylakoid membrane protein with a highly conserved structure across photosynthetic organisms. The protein contains two putative transmembrane domains in its N-terminal region and a large hydrophilic domain in its C-terminal region . Structurally, electron microscopy studies of purified Ycf4-containing complexes have revealed that the largest particles measure approximately 285 × 185 Å, suggesting several large oligomeric states .

Functionally, Ycf4 serves as a critical assembly factor for photosystem I (PSI), one of the two photosystems driving oxygenic photosynthesis. PSI is a multisubunit complex containing numerous chlorophyll molecules and iron-sulfur clusters that participates in the light-induced electron transfer chain. Through detailed biochemical studies, it has been established that Ycf4 forms a large complex (>1500 kD) that contains PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . This complex acts as a scaffold for PSI assembly, particularly during the initial steps involving the integration of the reaction center subunits PsaA and PsaB .

Pulse-chase protein labeling experiments have provided crucial insights into Ycf4's mechanism of action, revealing that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex . These findings strongly support the hypothesis that Ycf4 functions as a molecular scaffold for PSI assembly, mediating the interactions between newly synthesized PSI polypeptides during the early stages of the assembly process .

How is Ycf4 conserved across different species and what explains the differences in its essentiality?

Ycf4 is highly conserved among photosynthetic organisms from cyanobacteria to higher plants, indicating its fundamental importance in photosynthesis . The gene is encoded by the chloroplast genome in eukaryotes and has maintained significant sequence similarity throughout evolutionary history .

Despite this conservation, there are remarkable differences in Ycf4 essentiality across species:

OrganismYcf4 EssentialityPSI Accumulation in Ycf4 MutantsGrowth Phenotype
Chlamydomonas reinhardtiiEssentialNo PSI accumulationUnable to grow photoautotrophically
CyanobacteriaNon-essentialReduced PSI accumulationViable
TobaccoNon-essential10-20% of wild-type PSI levelsCapable of slow photoautotrophic growth

In the green alga Chlamydomonas reinhardtii, Ycf4 is essential for PSI complex assembly, and mutants deficient in Ycf4 do not accumulate PSI . Conversely, in cyanobacteria, a Ycf4-deficient mutant is still able to assemble the PSI complex, albeit at a reduced level, suggesting that Ycf4 plays a regulatory rather than essential role .

In higher plants like tobacco, comprehensive studies using chloroplast transformation to generate Ycf4 knockout mutants have demonstrated that while these plants are severely affected in their photosynthetic performance, they are still capable of photoautotrophic growth . This indicates that Ycf4 is not essential for photosynthesis in these organisms but plays an important role in optimizing PSI assembly.

Several hypotheses have been proposed to explain these differences:

  • Evolutionary divergence resulting in alternative assembly pathways in higher plants

  • The presence of compensatory mechanisms or redundant factors in some species

  • Differences in PSI structure and composition affecting assembly requirements

  • Varying thresholds of PSI needed for viability across species

What techniques are commonly employed to study Ycf4 function and PSI assembly?

Investigating Ycf4 function and PSI assembly requires sophisticated methodological approaches spanning biochemistry, molecular biology, and advanced imaging. The following techniques have proven particularly valuable:

  • Genetic Manipulation Techniques:

    • Chloroplast transformation for generating Ycf4 knockout mutants

    • Site-directed mutagenesis to study specific amino acid residues

    • RNA interference (RNAi) for reducing protein levels

    • CRISPR/Cas9 editing for precise genome modifications

  • Protein Purification and Analysis:

    • Tandem Affinity Purification (TAP) using tagged Ycf4

    • Sucrose gradient ultracentrifugation for complex separation

    • Ion exchange column chromatography for further purification

    • Blue native PAGE to visualize native protein complexes

  • Protein Identification and Interaction Studies:

    • Mass spectrometry (LC-MS/MS) for protein identification

    • Immunoblotting with specific antibodies

    • Co-immunoprecipitation to study protein interactions

    • Pulse-chase protein labeling to analyze assembly dynamics

  • Structural Analysis:

    • Transmission electron microscopy for visualizing complex structures

    • Single particle analysis for determining oligomeric states

    • Cryo-electron microscopy for high-resolution structural studies

  • Functional Assays:

    • Chlorophyll fluorescence measurements

    • P700 oxidation-reduction kinetics

    • Photosynthetic growth assays under various conditions

Implementation of these techniques has been instrumental in elucidating the role of Ycf4 in PSI assembly. For example, TAP-tagged Ycf4 purification in Chlamydomonas reinhardtii revealed a stable complex containing PSI subunits, providing direct evidence for Ycf4's role as an assembly factor . Similarly, site-directed mutagenesis studies identified specific amino acid residues (R120, E179, E181) critical for Ycf4 stability and function .

For researchers working with recombinant rice Ycf4, these established methodologies provide a foundation for investigating species-specific aspects of Ycf4 function in this agriculturally important crop.

What is known about the Ycf4 complex composition and its interactions with PSI components?

The Ycf4-containing complex represents a crucial intermediate in PSI assembly, with its composition providing key insights into the assembly process. Studies using tandem affinity purification and mass spectrometry have characterized this complex in detail:

The Ycf4 complex in Chlamydomonas reinhardtii includes:

  • Ycf4 (core component)

  • COP2 (opsin-related protein)

  • PSI subunits: PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF

This large complex (>1500 kD) appears to function as an assembly platform, with Ycf4 mediating the interactions between newly synthesized PSI polypeptides . Pulse-chase protein labeling experiments have provided valuable insights into the dynamics of these interactions, revealing that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized .

The assembly process appears to proceed in a stepwise manner, with the integration of the two large reaction center subunits, PsaA and PsaB, occurring as an initial step followed by the subsequent integration of peripheral subunits . Evidence suggests that Ycf4 is involved in early processes of PSI complex assembly, particularly in facilitating the formation of the PsaA-PsaB heterodimer .

Interestingly, almost all Ycf4 and COP2 in wild-type Chlamydomonas cells copurify during biochemical fractionation, indicating their intimate and exclusive association . RNA interference experiments reducing COP2 to 10% of wild-type levels increased the salt sensitivity of the Ycf4 complex stability but did not affect PSI accumulation, suggesting that COP2 contributes to complex stability but is not essential for PSI assembly .

How do site-directed mutations in Ycf4 affect its stability and function in PSI assembly?

Site-directed mutagenesis studies have provided crucial insights into the structure-function relationship of Ycf4, particularly regarding the roles of specific conserved amino acid residues in the protein's hydrophilic domain. These studies have focused on three highly conserved charged residues: R120, E179, and E181 .

Effects of R120 Mutations:
R120 is critical for Ycf4 stability. Mutations R120A and R120Q resulted in significant reductions in Ycf4 accumulation:

  • R120A/R120Q mutants: 20% of wild-type Ycf4 levels in logarithmic growth phase

  • Almost no detectable Ycf4 in stationary phase

Chloramphenicol incubation experiments confirmed that these mutations significantly increased Ycf4 instability rather than affecting synthesis . Interestingly, despite reduced Ycf4 levels, PSI accumulated at wild-type levels in these mutants, indicating that wild-type cells accumulate at least 5-fold more Ycf4 than required for normal PSI assembly under laboratory conditions .

Effects of E179 and E181 Mutations:
E179 and E181 play differential roles in PSI assembly:

MutationYcf4 Accumulation (% of WT)PSI Accumulation (% of WT)Effect on Assembly
E179Q~100%~100%Minimal effect
E181Q~100%~100%Minimal effect
E179A~50%~100%No impairment
E181A~30%~40%Significant reduction
E179A/E181AVery lowVery lowSevere impairment
E179Q/E181Q~70%10-20%Severe impairment

The E179Q/E181Q double mutant exhibited a particularly informative phenotype: despite accumulating Ycf4 at 70% of wild-type levels, PSI accumulated at only 10-20% of wild-type levels . Additionally, a PSI subcomplex containing PsaA, PsaB, and PsaF was detected in these cells, suggesting that these mutations impaired a late step in PSI complex assembly .

These findings indicate that:

  • R120 is primarily required for Ycf4 stability

  • E181 plays a more critical role in PSI assembly than E179

  • Wild-type cells maintain surplus Ycf4 levels, possibly to ensure rapid and efficient PSI synthesis under changing environmental conditions

  • Different residues in Ycf4 contribute to distinct aspects of its function (stability vs. assembly activity)

For researchers working with recombinant rice Ycf4, targeting the equivalent conserved residues would be a valuable approach for structure-function studies specific to this species.

What methodological approaches enable effective purification and analysis of the Ycf4-PSI complex?

Isolating and characterizing the large, membrane-bound Ycf4-PSI complex presents significant technical challenges requiring specialized methodologies. Based on successful approaches documented in the literature, researchers working with recombinant rice Ycf4 should consider the following comprehensive purification and analysis strategy:

Solubilization and Extraction:

  • Optimal detergent selection is crucial. Dodecyl maltoside (DDM) has proven effective for solubilizing the Ycf4 complex while maintaining its integrity .

  • The detergent-to-protein ratio must be carefully optimized to prevent complex dissociation while ensuring efficient solubilization.

  • Solubilization should be performed under gentle conditions (4°C with mild agitation) to preserve complex integrity.

Affinity Purification:
The tandem affinity purification (TAP) approach has proven particularly successful for isolating the Ycf4 complex:

  • First Affinity Step:

    • For TAP-tagged constructs: Incubation with IgG agarose (overnight at 4°C in a rotating column for optimal binding)

    • Washing with detergent-containing buffer to remove non-specifically bound proteins

    • Elution by TEV protease cleavage (16°C for 1 hour)

  • Second Affinity Step:

    • Application of the eluate to calmodulin resin

    • Binding in the presence of calcium

    • Elution with EGTA-containing buffer

This two-step approach can achieve high purity while maintaining complex integrity, as demonstrated in studies with Chlamydomonas Ycf4 .

Additional Purification Techniques:

  • Sucrose Gradient Ultracentrifugation: 15-55% sucrose gradients run at 141,000g for 16 hours effectively separate the large Ycf4 complex

  • Ion Exchange Chromatography: DEAE-Toyopearl column chromatography with a linear NaCl gradient (0-400 mM) provides further purification

  • Size Exclusion Chromatography: Superose 6 columns can separate complexes based on size while maintaining native state

Analytical Methods:

By implementing this integrated methodological approach, researchers can effectively purify and characterize the recombinant rice Ycf4-PSI complex, providing insights into its structure, composition, and function specific to this agriculturally important species.

How can temporal dynamics of Ycf4-assisted PSI assembly be monitored experimentally?

Investigating the kinetics and sequential events of Ycf4-assisted PSI assembly requires sophisticated experimental approaches that can track this process with temporal resolution. Several complementary methodologies have proven valuable for such studies and can be adapted for research with recombinant rice Ycf4:

1. Pulse-Chase Protein Labeling:
This technique provides direct insights into the dynamics of protein synthesis, complex formation, and turnover:

  • Protocol Implementation: Briefly expose cells to radioactively labeled amino acids (typically 35S-methionine) for 5-10 minutes, followed by addition of excess unlabeled amino acids .

  • Time-Course Sampling: Collect samples at defined intervals (0, 5, 15, 30, 60 minutes) during the chase period.

  • Analysis Methods:

    • Native PAGE to preserve complexes, followed by autoradiography

    • Immunoprecipitation with Ycf4-specific antibodies to isolate complexes

    • Two-dimensional gel electrophoresis (BN-PAGE followed by SDS-PAGE) to resolve components

This approach has revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and represent assembly intermediates . The appearance and disappearance of labeled proteins from the complex can be monitored over time to establish the sequence and rates of assembly events.

2. Inducible Expression Systems:
Controlled induction of PSI component expression provides a defined starting point for assembly studies:

  • Establish transgenic lines with PSI subunits under inducible promoters

  • Synchronize induction and monitor complex formation over time

  • Combine with Ycf4 mutations or altered expression to assess impacts on assembly kinetics

3. Time-Resolved Structural Studies:

  • Cryo-Electron Microscopy Time Series: Sample the assembly process at different time points and analyze structures to visualize assembly intermediates.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can reveal changes in protein conformation and interactions during assembly by measuring deuterium incorporation over time.

  • Time-Resolved Fluorescence Spectroscopy: When combined with site-specific labeling, this can monitor conformational changes during assembly.

4. In Vitro Reconstitution with Temporal Monitoring:
For studies with recombinant rice Ycf4, in vitro reconstitution offers precise control:

  • Combine purified recombinant Ycf4 with individual or combinations of PSI subunits

  • Add components sequentially and monitor complex formation

  • Employ real-time analytical techniques such as:

    • Light scattering to track complex size evolution

    • Fluorescence resonance energy transfer (FRET) for monitoring protein-protein interactions

    • Surface plasmon resonance for binding kinetics

    • Quartz crystal microbalance for mass changes during assembly

5. Synchronized Growth Studies:

  • Subject photosynthetic organisms to controlled light/dark cycles to synchronize PSI synthesis

  • Sample during transitions to monitor assembly dynamics

  • Analyze Ycf4 complex composition at defined time points during greening of etiolated plants

6. Quantitative Proteomics:

  • Stable isotope labeling with amino acids in cell culture (SILAC) or isobaric tagging for relative and absolute quantitation (iTRAQ) to monitor protein abundance changes

  • Selected reaction monitoring (SRM) mass spectrometry for targeted quantification of specific components

  • Analysis of stoichiometric relationships during complex assembly

By integrating these methodological approaches, researchers can construct a comprehensive temporal map of Ycf4-assisted PSI assembly in rice, identifying rate-limiting steps and regulatory checkpoints in this critical process.

Understanding the critical molecular determinants of Ycf4 function is essential for elucidating its mechanism of action and potentially for engineering improved photosynthetic efficiency. Several key structural and sequence features have been identified as crucial for Ycf4's role in PSI assembly:

1. Transmembrane Domains:
Ycf4 contains two putative transmembrane domains in its N-terminal region that anchor the protein in the thylakoid membrane . These domains are essential for:

  • Proper localization within the thylakoid membrane

  • Orientation of the hydrophilic domain toward the stromal side

  • Potential interaction with membrane-embedded portions of PSI subunits

The precise positioning of Ycf4 in the membrane appears critical for its function, allowing it to serve as a scaffold for assembling PSI components at the correct location and orientation .

2. Conserved Charged Residues:
Site-directed mutagenesis studies have identified specific amino acid residues in the hydrophilic domain that are crucial for Ycf4 function:

ResidueConservationFunctionEffect of MutationReference
R120Highly conservedProtein stabilityR120A/Q: Reduced Ycf4 stability
E179Highly conservedAssembly activityE179A: Reduced Ycf4 levels but normal PSI
E181Highly conservedAssembly activityE181A: Reduced PSI accumulation
E179/E181Highly conservedAssembly activityDouble mutants: Severe PSI assembly defects

The differential effects of these mutations suggest that:

3. Hydrophilic Domain:
The large hydrophilic domain in the C-terminal region of Ycf4 extends into the stroma and appears to be the primary functional region for PSI assembly . This domain likely:

  • Provides binding sites for PSI subunits

  • Mediates interactions with other assembly factors

  • Undergoes conformational changes during the assembly process

Structural predictions suggest this domain may contain protein-protein interaction motifs that facilitate its scaffolding function .

4. Oligomerization Capacity:
Electron microscopy studies of purified Ycf4-containing complexes reveal large structures (285 × 185 Å), suggesting that oligomerization is an important feature of Ycf4 function . This oligomeric organization may:

  • Create a platform large enough to accommodate multiple PSI subunits simultaneously

  • Enhance the stability of assembly intermediates

  • Allow for cooperative binding of PSI components

5. Species-Specific Features:
While core features are conserved across species, some adaptations appear to be species-specific:

  • In Chlamydomonas, association with COP2 contributes to complex stability

  • In higher plants like rice, the functional domains remain conserved, but interaction partners may differ

For researchers working with recombinant rice Ycf4, structural mapping of these essential features onto the rice protein sequence would provide valuable guidance for mutagenesis studies. Computational models based on sequence conservation suggest that rice Ycf4 likely maintains the critical charged residues in its hydrophilic domain, potentially indicating a conserved mechanism of action despite differences in essentiality compared to green algae.

How can recombinant Oryza sativa Ycf4 be used for in vitro reconstitution of PSI assembly?

Recombinant Oryza sativa Ycf4 offers valuable opportunities for in vitro reconstitution studies to dissect the molecular mechanisms of PSI assembly under controlled conditions. A comprehensive experimental framework would include:

1. Optimized Production of Functional Recombinant Ycf4:

The full-length rice Ycf4 protein sequence (185 amino acids) can be expressed using several systems, each with specific considerations:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliHigh yield, low costMembrane protein folding issuesUse specialized strains (C41/C43), fusion tags, low temperature induction
YeastEukaryotic processingLower yieldsCodon optimization, inducible promoters
Insect cellsSuperior for membrane proteinsHigher cost, complexityBaculovirus optimization, scaled production

For membrane protein reconstitution, additional steps are critical:

  • Solubilization using mild detergents (DDM, digitonin)

  • Incorporation into liposomes or nanodiscs to mimic the native membrane environment

  • Verification of proper folding using circular dichroism spectroscopy and intrinsic fluorescence

2. In Vitro Assembly System Design:

A complete reconstitution system requires the following components:

  • Purified recombinant rice Ycf4 in membrane mimetics

  • PSI subunits (either purified from rice chloroplasts or recombinantly produced)

  • Appropriate cofactors (chlorophylls, carotenoids, iron-sulfur clusters)

  • Energy source (ATP/GTP) and physiological buffer conditions

  • Light conditions mimicking natural assembly environment

The experimental design should include:

  • Sequential addition experiments to determine the order of subunit incorporation

  • Time-course studies to establish assembly kinetics

  • Varying conditions (pH, salt, temperature) to optimize assembly efficiency

  • Control experiments without Ycf4 to establish its specific contribution

3. Analytical Framework for Monitoring Assembly:

Multiple complementary techniques should be employed to monitor assembly progress:

TechniqueInformation ProvidedApplication in Assembly Studies
Blue native PAGENative complex formationVisualize assembly intermediates and final complexes
Sucrose gradient ultracentrifugationSize-based separationIsolate and characterize assembly intermediates
Analytical ultracentrifugationPrecise size determinationMonitor complex growth during assembly
Mass spectrometryComposition analysisIdentify components of assembly intermediates
Electron microscopyStructural visualizationObserve architectural changes during assembly
Absorption/fluorescence spectroscopyPigment incorporationMonitor chlorophyll integration and energy transfer
Surface plasmon resonanceBinding kineticsMeasure interactions between Ycf4 and PSI subunits

4. Functional Verification of Assembled Complexes:

To confirm successful assembly, functional assays are essential:

  • P700 oxidation measurements to verify reaction center functionality

  • Electron transfer assays (PSI-mediated ferredoxin reduction)

  • Energy transfer measurements using time-resolved fluorescence

  • Structural comparison with native PSI complexes

5. Mechanistic Studies Using Modified Components:

Once the basic reconstitution system is established, more sophisticated experiments become possible:

  • Mutant versions of rice Ycf4 (based on the Chlamydomonas R120, E179, E181 equivalents) to identify critical functional residues

  • Truncated versions to map functional domains

  • Crosslinking experiments to identify specific interaction sites

  • Competition experiments with individual PSI subunits to determine binding hierarchy

6. Comparative Studies with Ycf4 from Different Species:

Including Ycf4 from Chlamydomonas or tobacco alongside rice Ycf4 in parallel reconstitution experiments could reveal:

  • Species-specific differences in assembly mechanisms

  • Evolutionary adaptations in PSI assembly pathways

  • Potential for heterologous complementation

This comprehensive in vitro reconstitution approach would provide unprecedented insights into the molecular mechanisms of Ycf4-mediated PSI assembly in rice, potentially informing strategies for enhancing photosynthetic efficiency in this crucial crop species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.