Recombinant Oryza sativa Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Oryza sativa CP47 (psbB) is a 508-amino acid protein (UniProt ID: P0C362) expressed in E. coli with an N-terminal His-tag for purification . It belongs to the PSII core complex, functioning as a chlorophyll-binding antenna that transfers excitation energy to the reaction center .

PropertySpecification
SpeciesOryza sativa (Rice)
Expression HostE. coli
Protein LengthFull-length (1-508 aa)
Molecular Weight~56 kDa (predicted from sequence)
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); avoid freeze-thaw

Domain Architecture

  • Binds 14–16 chlorophyll molecules via six transmembrane helices, facilitating energy transfer to the PSII reaction center .

  • Contains conserved motifs critical for interaction with D1/D2 proteins and the oxygen-evolving enhancer (OEE) complex .

Key Roles in Photosynthesis

  1. Light Harvesting: Acts as an internal antenna, optimizing chlorophyll alignment for energy capture .

  2. PSII Assembly: Stabilizes the D1/D2 reaction center during PSII biogenesis .

  3. Oxygen Evolution: Coordinates with the manganese cluster to enable water splitting .

Expression and Purification

  • Cloning: Full-length psbB gene cloned into E. coli vectors for high-yield expression .

  • Reconstitution: Lyophilized powder reconstituted in sterile water (0.1–1.0 mg/mL) with glycerol for stability .

Research Applications

  • Structural Studies: Used in cryo-EM/X-ray crystallography to resolve PSII architecture .

  • Mutagenesis: Investigating chlorophyll-protein interactions and photodamage repair mechanisms .

  • Antibody Development: Detected by polyclonal antibodies (e.g., Agrisera AS10 712) for immunoblotting .

Comparative Analysis

While rice CP47 shares 89% sequence identity with Lactuca sativa CP47 (UniProt Q332V1), variations in residues 205–215 correlate with species-specific light adaptation .

Challenges and Future Directions

Current limitations include instability during purification and incomplete chlorophyll incorporation in vitro . Advances in fusion tags and lipid-based reconstitution systems aim to improve functional assays .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is preferred, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; PA090; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oryza sativa (Rice)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQPV
Uniprot No.

Target Background

Function
CP47, a component of the Photosystem II (PSII) core complex, is essential for the photosynthetic process in plants. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from water, generating oxygen and a proton gradient, ultimately driving ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is recombinant Oryza sativa psbB typically expressed and purified for research?

The expression and purification of recombinant Oryza sativa psbB typically follows established protocols for membrane proteins with chlorophyll cofactors. The process generally involves:

  • Gene cloning: The psbB gene (P0C362) is cloned into an appropriate expression vector with a fusion tag to facilitate purification.

  • Expression system selection: Due to its complex nature as a chlorophyll-binding protein, expression systems capable of proper protein folding and cofactor incorporation are preferred. This may include specialized E. coli strains, yeast, or insect cell systems.

  • Induction conditions: Optimization of temperature, inducer concentration, and expression duration is critical for maximizing functional protein yield.

  • Membrane isolation: Following cell lysis, membrane fractions are isolated through differential centrifugation.

  • Solubilization: Detergent solubilization (typically mild non-ionic detergents) is used to extract the protein from membranes.

  • Affinity chromatography: The tagged protein is purified using affinity chromatography.

  • Additional purification steps: Size-exclusion chromatography and ion-exchange chromatography may be employed to achieve high purity.

  • Storage: The purified protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability .

When evaluating purification success, researchers should assess both protein purity and structural integrity, as maintaining the native conformation with properly incorporated chlorophyll molecules is essential for functional studies.

What spectroscopic methods are used to characterize CP47 chlorophyll apoprotein?

Several spectroscopic methods are employed to characterize the CP47 chlorophyll apoprotein:

  • Absorption spectroscopy: Provides information about the chlorophyll content and environment within the protein. The characteristic absorption bands in the blue (Soret band) and red (Qy) regions offer insights into chlorophyll-protein interactions.

  • Circular dichroism (CD) spectroscopy: Used to analyze the secondary structure of the protein and the excitonic coupling between chlorophylls.

  • Fluorescence spectroscopy: Enables the investigation of excitation energy transfer between chlorophylls, with emission spectra revealing energy transfer pathways.

  • Time-resolved fluorescence: Provides information about the kinetics of excitation energy transfer processes within the CP47 complex.

  • Resonance Raman spectroscopy: Offers insights into the vibrational properties of chlorophylls and their protein environment.

  • 77K fluorescence emission spectroscopy: Performed at low temperature to reduce thermal broadening, allowing better resolution of spectral features and identification of specific chlorophyll populations.

  • Two-dimensional electronic spectroscopy: Advanced technique used to map energy transfer pathways and dynamics within the complex.

When applying these methods, researchers should carefully consider sample preparation, protein stability in the measurement conditions, and the presence of detergents that might influence spectroscopic properties .

How do site energies of chlorophylls in CP47 influence excitation energy transfer pathways?

The site energies of the 16 chlorophyll molecules within CP47 critically determine the directionality and efficiency of excitation energy transfer pathways. Recent quantum mechanics/molecular mechanics (QM/MM) studies using time-dependent density functional theory have revealed important insights into this process:

  • Energy landscape: The distribution of site energies creates an energy landscape that generally funnels excitation energy toward the reaction center. Computational studies have identified that chlorophylls B3 and B1 have the most red-shifted energies, contrary to previous hypotheses in the literature .

  • Excitonic coupling: The relative positioning of chlorophylls and their transition dipole orientations determine the strength of excitonic coupling between them, which directly affects energy transfer rates.

  • Protein environment effects: The protein matrix surrounding each chlorophyll creates unique electrostatic environments that shift absorption energies. These shifts can be quantified through QM/MM calculations that incorporate the protein's electrostatic field .

  • Directional energy flow: The hierarchical arrangement of chlorophyll site energies establishes preferred pathways for energy transfer, typically leading to the reaction center.

The following table summarizes comparative rankings of the most red-shifted chlorophylls in CP47 from different studies:

ChlorophyllCurrent QM/MM StudiesPrevious Semi-empirical ModelsExperimental Assignment
B3Most red-shiftedModerately red-shiftedVariably assigned
B1Second most red-shiftedVariably assignedVariably assigned
B14Moderately red-shiftedMost red-shifted in some modelsStrongly coupled
B16Near average energyRed-shifted in some modelsPotential low-energy site

Understanding these site energies provides crucial insights for designing artificial light-harvesting systems and interpreting spectroscopic data. Current research suggests that traditional semi-empirical models may need revision based on high-level quantum chemical calculations .

What experimental approaches can detect conformational changes in CP47 during light harvesting?

Detecting conformational changes in CP47 during light harvesting requires sophisticated time-resolved experimental techniques:

  • Time-resolved X-ray crystallography: Using ultrashort X-ray pulses from free-electron lasers to capture structural snapshots during light activation. This technique can detect subtle changes in protein backbone and chlorophyll orientations with high spatial resolution.

  • Time-resolved FTIR spectroscopy: Capable of identifying changes in hydrogen bonding networks and secondary structure elements following light excitation.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Used to probe changes in solvent accessibility of different protein regions upon light activation, indicating conformational rearrangements.

  • Single-molecule FRET spectroscopy: By labeling specific domains with fluorescent probes, researchers can monitor distance changes between protein regions during energy transfer.

  • Cryo-electron microscopy (cryo-EM): Enables visualization of different conformational states by trapping the protein in various functional states using rapid freezing techniques.

  • Site-directed spin labeling coupled with EPR spectroscopy: Provides information about distances between labeled sites and their changes during light-induced processes.

When implementing these approaches, researchers should consider appropriate control experiments and carefully design data collection protocols to ensure the observed changes reflect physiologically relevant conformational dynamics rather than artifacts. Time resolution is particularly critical, as many energy transfer processes occur on picosecond to nanosecond timescales .

How do mutations in the psbB gene affect PSII assembly and function?

Mutations in the psbB gene can profoundly impact both the assembly and function of Photosystem II through several mechanisms:

When studying such mutations, researchers should implement a multi-technique approach combining biochemical analyses (protein accumulation, complex formation), spectroscopic methods (absorption, fluorescence), and functional assays (oxygen evolution, electron transfer rates) to comprehensively characterize the mutant phenotypes and establish structure-function relationships.

What are the optimal conditions for maintaining stability of isolated CP47 protein?

Maintaining the stability of isolated CP47 protein presents significant challenges due to its hydrophobic nature and dependence on chlorophyll cofactors. The following conditions have been empirically determined to enhance stability:

  • Buffer composition:

    • 25-50 mM Tris or HEPES buffer at pH 7.5-8.0

    • 100-200 mM NaCl to maintain ionic strength

    • 5-10% glycerol to prevent freeze-thaw damage

    • Addition of 1-5 mM MgCl₂ to stabilize chlorophyll interactions

  • Detergent selection:

    • Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at concentrations slightly above critical micelle concentration

    • Alternative approaches include reconstitution into liposomes or nanodiscs for increased stability

  • Temperature considerations:

    • Storage at -80°C for long-term preservation

    • Working temperature of 4°C for experiments

    • Avoiding repeated freeze-thaw cycles

  • Oxidative damage prevention:

    • Addition of reducing agents such as 1-2 mM dithiothreitol (DTT)

    • Handling under dim green light to prevent photooxidation

    • Conducting procedures under nitrogen atmosphere when possible

  • Protease inhibition:

    • Addition of protease inhibitor cocktails during purification and storage

Researchers should monitor protein stability using a combination of methods, including absorption spectroscopy to track chlorophyll retention, size-exclusion chromatography to detect aggregation, and functional assays to assess biological activity .

What computational approaches effectively predict chlorophyll-protein interactions in CP47?

Several computational approaches have proven effective for predicting and analyzing chlorophyll-protein interactions in CP47:

  • Quantum mechanics/molecular mechanics (QM/MM) methods: These hybrid approaches treat the chlorophyll molecules and immediate protein environment with quantum mechanical methods while representing the rest of the system with molecular mechanics. Recent studies have employed time-dependent density functional theory with modern range-separated functionals to compute excitation energies of all CP47 chlorophylls in a complete membrane-embedded cyanobacterial PSII dimer .

  • Molecular dynamics simulations: Used to investigate the dynamics of protein-chlorophyll interactions over time, revealing flexibility in binding pockets and transient interactions. These simulations typically employ specialized force fields that accurately represent both the protein and the unique chemical properties of chlorophylls.

  • Electrostatic potential calculations: The protein environment creates unique electrostatic fields that influence chlorophyll excitation energies. Methods like Poisson-Boltzmann calculations can quantify these effects.

  • Quantum chemical cluster models: Focused studies of individual chlorophyll binding sites using high-level ab initio methods can provide detailed insights into coordination geometry and electronic structure.

  • Exciton coupling calculations: These approaches use transition dipole moment orientations derived from structural data to predict excitonic interactions between chlorophylls.

The computational protocol typically involves:

  • Starting with high-resolution structural data

  • Hydrogen atom placement and refinement

  • Assignment of protonation states for titratable residues

  • System solvation and embedding in a membrane environment

  • Energy minimization and equilibration

  • Production calculations with appropriate QM methods

When applying these approaches, researchers should be aware of their relative strengths and limitations. QM/MM methods provide the most accurate description of electronic properties but are computationally intensive. Molecular dynamics offers insights into dynamics but may not capture electronic effects adequately. The most robust studies often combine multiple computational approaches with experimental validation .

What are the main contradictions in current research data regarding CP47 function?

Several significant contradictions remain unresolved in current CP47 research:

  • Identity of low-energy chlorophylls: There are conflicting assignments of the most red-shifted chlorophylls in CP47. While recent quantum chemical calculations identify chlorophylls B3 and B1 as having the lowest site energies, previous semi-empirical models and spectroscopic assignments have suggested alternative chlorophylls such as B14 and B16. These discrepancies have significant implications for understanding energy transfer pathways .

  • Functional flexibility: It remains unclear whether CP47 undergoes significant conformational changes during light harvesting. Some studies suggest a relatively rigid structure, while others indicate dynamic structural adjustments that optimize energy transfer under varying light conditions.

  • Pathway redundancy: There is ongoing debate about whether excitation energy follows specific, defined pathways through the chlorophyll network or whether multiple parallel routes operate simultaneously with varying efficiencies.

  • Species-specific differences: Significant variations have been observed between CP47 from different species (e.g., cyanobacteria vs. higher plants), but it remains unclear whether these represent fundamental functional differences or adaptations to specific environmental conditions.

  • Role in photoprotection: Evidence is mixed regarding CP47's involvement in photoprotective mechanisms. Some studies suggest it participates actively in non-photochemical quenching, while others indicate it serves primarily as a light harvester without direct photoprotective functions.

These contradictions highlight the need for integrated approaches combining high-resolution structural studies, advanced spectroscopy, and sophisticated computational modeling to develop a comprehensive understanding of CP47 function across different species and conditions .

How can researchers design experiments to distinguish between competing models of energy transfer in CP47?

Designing experiments to distinguish between competing models of energy transfer in CP47 requires strategic approaches that can provide discriminating evidence:

The experimental design should include appropriate controls and multiple technical and biological replicates. Additionally, researchers should consider using single-subject experimental design principles to establish causal relationships between specific structural features and observed energy transfer properties .

What emerging technologies show promise for advancing CP47 research?

Several emerging technologies show exceptional promise for advancing our understanding of CP47 structure, function, and dynamics:

  • Cryo-electron microscopy (cryo-EM) with improved resolution:

    • Recent advances in detector technology and image processing allow near-atomic resolution

    • Potential to visualize subtle conformational states not captured in crystallographic studies

    • Ability to study CP47 in different functional states within the complete PSII complex

    • Reduced radiation damage compared to traditional X-ray crystallography

  • Time-resolved serial femtosecond crystallography (TR-SFX):

    • Uses X-ray free electron lasers to capture ultrafast structural changes

    • Potential to observe transient conformational changes during energy transfer

    • "Diffraction before destruction" approach minimizes radiation damage

    • Can potentially create molecular movies of CP47 during function

  • Quantum biology experimental approaches:

    • Advanced spectroscopic techniques to detect quantum coherence effects in energy transfer

    • Multi-dimensional electronic spectroscopy with improved temporal resolution

    • Investigation of potential quantum mechanical effects in light harvesting

    • Correlation of quantum phenomena with protein structural features

  • AI-enhanced structural prediction and data analysis:

    • Machine learning approaches to predict protein-pigment interactions

    • Neural networks trained on spectroscopic data to identify subtle patterns

    • Advanced data mining of existing datasets to generate new hypotheses

    • Automated analysis of high-throughput mutational studies

  • Nanoscale imaging techniques:

    • Super-resolution fluorescence microscopy to visualize CP47 in cellular contexts

    • Atomic force microscopy with chemical specificity

    • Tip-enhanced Raman spectroscopy for nanoscale chemical mapping

    • Integration of multiple imaging modalities for comprehensive structural-functional analysis

  • Synthetic biology approaches:

    • Designer CP47 variants with non-natural amino acids for specific probing

    • Minimal synthetic systems to test fundamental principles

    • In vitro evolution to generate CP47 variants with enhanced or altered properties

    • Integration of engineered CP47 into artificial photosynthetic systems

These technologies, especially when used in combination, have the potential to resolve current contradictions in the field and provide unprecedented insights into the molecular mechanisms of light harvesting in CP47 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.