Recombinant Oryza sativa Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Biological Role in Photosystem II

The D2 protein partners with D1 to form the PSII reaction center, enabling:

  • Light Harvesting: Absorption of photons to excite electrons .

  • Water Oxidation: Stabilization of the oxygen-evolving complex (OEC) .

  • Electron Transport: Mediation of electron transfer from water to plastoquinone .

Key Functional Insights:

  • Regulation by PTF1: A nuclear-encoded basic helix-loop-helix protein (PTF1) binds to the ACC repeat in the psbD promoter, enhancing light-responsive transcription .

  • Stress Adaptation: Mutations in auxiliary proteins like PAP90 destabilize D1, indirectly impairing D2 function and PSII efficiency under stress .

  • Repair Cycle: Damaged D2 is replaced via a phosphorylation-dependent repair pathway involving STN8 kinase and THF1/NYC4 proteins .

Research Applications

Recombinant psbD is widely used in:

  1. Biochemical Studies: Investigating PSII assembly, photodamage, and repair mechanisms .

  2. Antibody Production: Polyclonal antibodies (e.g., AS06 146) target conserved epitopes for immunodetection across plant species .

  3. Structural Biology: Crystallization and molecular dynamics studies of PSII complexes .

Transcriptional Regulation

  • The psbD promoter’s AAG box contains an ACC repeat bound by PTF1, which enhances mRNA accumulation under light . Disruption of this motif reduces transcription by 60% .

Mutational Analysis

  • PAP90 Mutant: Rice lacking PAP90 shows reduced D1 stability, leading to ROS accumulation and PSII dysfunction . This highlights D2’s dependence on auxiliary proteins for structural integrity.

Evolutionary Conservation

  • The ACC/GACC repeat in psbD is conserved across angiosperms, suggesting a universal regulatory mechanism for light adaptation .

Challenges and Future Directions

  • Expression Limitations: Recombinant psbD production in E. coli often yields insoluble protein, complicating in vitro studies .

  • Functional Redundancy: Overlapping roles of D1 and D2 in PSII necessitate advanced mutagenesis to delineate subunit-specific functions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
psbD; PA018; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Oryza sativa (Rice)
Target Names
psbD
Target Protein Sequence
MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. PSII consists of a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of PsbD (D2) protein in Photosystem II?

PsbD functions as one half of the heterodimeric reaction center in Photosystem II, partnering with the D1 protein to form the core of PSII. This heterodimer is crucial for water-plastoquinone oxidoreductase activity, which enables water splitting, oxygen evolution, and plastoquinone reduction . The D2 protein is homologous to D1 but with a slightly higher molecular mass of approximately 39.5 kDa .

The accumulation of D2 protein represents a critical step in the assembly of the PSII reaction center complex. Without proper D2 expression and integration, PSII cannot form functional complexes capable of initiating photosynthetic electron transport .

How can researchers extract and isolate native PsbD protein from Oryza sativa for comparative studies?

The isolation of native PsbD protein from Oryza sativa involves several methodological steps:

  • Thylakoid membrane isolation: Harvest rice leaf tissue (typically 20-30g) and homogenize in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 5 mM MgCl₂, 10 mM NaCl, and 2 mM EDTA) with protease inhibitors.

  • Membrane solubilization: Resuspend isolated thylakoid membranes in solubilization buffer containing 25 mM BisTris-HCl (pH 7.0), 20% glycerol, and 1.0% n-dodecyl-β-D-maltoside (β-DM).

  • Protein separation: Use a combination of sucrose gradient ultracentrifugation and ion exchange chromatography to separate PSII complexes.

  • Confirmation: Verify D2 protein isolation using Western blot analysis with specific anti-PsbD antibodies (such as the rabbit polyclonal antibody AS06 146) .

  • Purity assessment: Analyze by BN-PAGE followed by SDS-PAGE in the second dimension to confirm protein composition of isolated complexes.

For comparative studies, isolated native protein can be analyzed alongside recombinant versions using various spectroscopic and biochemical techniques.

What detection methods are most effective for monitoring PsbD protein expression levels?

Detection MethodSensitivityApplicationsLimitations
Western blottingHigh (ng range)Protein quantity assessment, molecular weight confirmationSemi-quantitative without proper controls
ELISAVery high (pg range)Precise quantificationRequires specific antibodies
Mass spectrometryHighIdentification and quantification of post-translational modificationsExpensive equipment required
ImmunofluorescenceModerateCellular localizationLimited quantification capability

Western blotting using specific anti-PsbD antibodies remains the most widely utilized detection method. Polyclonal rabbit antibodies such as AS06 146 have been extensively validated for PsbD detection across multiple species, including Oryza sativa . For optimal results when monitoring PsbD levels during experimental manipulations, researchers should normalize loading by fresh weight rather than total protein content, as photosynthetic protein levels can vary significantly based on growth conditions .

What expression systems are suitable for producing recombinant Oryza sativa PsbD protein?

The expression of functional recombinant PsbD presents significant challenges due to its hydrophobic nature and requirement for cofactor association and proper folding. Several expression systems have been evaluated:

  • E. coli-based systems: While widely accessible, they often result in inclusion body formation requiring refolding protocols. Success has been reported using specialized strains (C41/C43) combined with fusion tags (MBP, SUMO) to enhance solubility.

  • Chloroplast transformation in model organisms: Expression within Chlamydomonas reinhardtii chloroplasts provides a native-like environment with appropriate chaperones and assembly factors.

  • Cell-free expression systems: These allow controlled incorporation into liposomes or nanodiscs, facilitating proper membrane protein folding.

  • Insect cell/baculovirus systems: These eukaryotic systems provide better membrane protein processing capabilities than bacterial systems.

Expression yields are typically monitored through Western blotting with anti-PsbD antibodies, with functional assessment requiring reconstitution experiments and spectroscopic analyses.

How does the light-dependent regulation of PsbD synthesis differ from other PSII components?

Light regulation of PsbD synthesis demonstrates distinctive characteristics compared to other PSII components. Research indicates that:

  • Transcriptional versus translational control: While light significantly enhances translation of plastid-encoded PSII proteins, transcription is less strictly light-dependent. Studies show that significant levels of psbD transcripts exist even in etiolated seedlings in constant dark conditions, with only modest increases following light exposure .

  • Comparative regulation pattern: Unlike nuclear-encoded genes like Lhcb1 and HCF173 that show dramatic light-induced transcriptional increases, psbD exhibits a different regulatory pattern :

ProteinGene LocationTranscriptional Light ResponseTranslational Light Response
D2 (PsbD)ChloroplastSlight increaseStrong increase
D1 (PsbA)ChloroplastSlight increaseStrong increase
Lhcb1NuclearStrong increaseProportional to transcript
HCF173NuclearStrong increaseProportional to transcript
  • Redox-based regulation mechanism: Evidence indicates that PsbD synthesis is regulated through a redox-sensitive mechanism. Certain proteins that associate with psbD mRNA do so in a light-dependent manner through redox-based mechanisms, as demonstrated with regulatory factors like LPE1 .

This differential regulation highlights the complex coordination between nuclear and chloroplast gene expression during PSII biogenesis and maintenance.

What methodologies are most effective for studying PsbD-protein interactions within the PSII complex?

Several complementary approaches provide insights into PsbD protein interactions:

  • Co-immunoprecipitation (Co-IP): Using anti-PsbD antibodies to pull down interaction partners, followed by mass spectrometry identification. This technique has revealed associations between PsbD and various assembly factors.

  • Yeast two-hybrid (Y2H) adaptations: Modified membrane Y2H systems can detect interactions between membrane proteins, though results require validation through other methods.

  • Bimolecular Fluorescence Complementation (BiFC): This technique visualizes protein interactions in vivo by reconstituting a fluorescent protein when two interacting proteins tagged with complementary fragments come together .

  • Förster Resonance Energy Transfer (FRET): Measures energy transfer between fluorophore-tagged proteins to detect nanometer-scale proximity.

  • Chemical cross-linking coupled with mass spectrometry (CX-MS): This approach captures transient interactions by covalently linking proteins in close proximity before identification.

  • Blue Native PAGE (BN-PAGE): Separates protein complexes in their native state, followed by second-dimension SDS-PAGE to identify components.

What strategies can overcome the challenges in expressing functional recombinant Oryza sativa PsbD protein?

Expressing functional recombinant PsbD presents significant challenges due to its membrane-embedded nature, cofactor requirements, and complex assembly process. Successful strategies include:

  • Codon optimization: Adjusting the coding sequence to match the preferred codon usage of the expression host can significantly improve translation efficiency.

  • Fusion tag selection: Strategic tag placement can enhance solubility while minimizing interference with function:

Fusion TagPositionBenefitsPotential Issues
SUMON-terminalEnhanced solubility, removableMay alter initial folding
His6/His10C-terminalEfficient purificationPotential interference with C-terminal interactions
MBPN-terminalSignificant solubility enhancementLarge size may affect structure
Strep-tag IIC-terminalGentle elution conditionsLower affinity than His-tag
  • Membrane mimetics: Incorporation of appropriate lipids or detergents during expression and purification to provide suitable hydrophobic environments.

  • Co-expression with assembly factors: Expressing PsbD alongside known assembly factors and chaperones can improve folding and stability.

  • Refolding protocols: For inclusion body-derived protein, stepwise refolding with redox control and cofactor addition has shown success.

  • Functional verification: Confirming proper folding and function through circular dichroism spectroscopy, cofactor binding assays, and reconstitution experiments with other PSII components.

The choice of strategy should be guided by the intended experimental applications, with structural studies generally requiring higher purity and homogeneity than functional assays.

How do post-translational modifications affect PsbD stability and function?

PsbD undergoes several post-translational modifications (PTMs) that significantly influence its stability, turnover, and functional properties:

  • Phosphorylation: Under high light conditions, PsbD phosphorylation status changes as part of the PSII repair cycle. This modification affects the protein's stability and interaction with other components of the photosynthetic machinery.

  • Oxidative modifications: The formation of carbonyl groups and other oxidative modifications on specific residues serves as markers for damage and triggers replacement of the protein.

  • Proteolytic processing: N-terminal processing occurs during maturation and affects integration into the thylakoid membrane.

Analysis of these modifications requires specialized techniques:

PTM TypeDetection MethodFunctional Assessment
PhosphorylationPhospho-specific antibodies, Pro-Q Diamond staining, MS/MSDephosphorylation assays, site-directed mutagenesis
Oxidative modificationsOxyBlot, LC-MS/MS, amino acid analysisComparison of modification rates under stress conditions
Proteolytic processingN-terminal sequencing, mass shift analysisProtein stability assays

Understanding these modifications is essential for interpreting how environmental stresses affect PSII function and turnover, particularly when comparing native and recombinant proteins.

What methods are most reliable for assessing the proper folding and assembly of recombinant PsbD?

Evaluating proper folding and assembly of recombinant PsbD requires multiple complementary approaches:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to monitor chlorophyll and cofactor binding

    • Fourier-transform infrared spectroscopy (FTIR) to evaluate structural features of membrane proteins

  • Functional assays:

    • Electron transfer measurements using artificial electron acceptors

    • Oxygen evolution measurements when reconstituted with other PSII components

    • Herbicide binding assays, as herbicides like DCMU bind to the QB pocket, which involves D2

  • Structural integrity assessment:

    • Limited proteolysis to compare digestion patterns between recombinant and native proteins

    • Thermal stability assays to measure protein unfolding transitions

    • Native gel electrophoresis to assess complex formation

  • Interaction studies:

    • Co-immunoprecipitation with known interacting partners

    • Surface plasmon resonance to measure binding kinetics with other PSII components

When assessing recombinant PsbD folding, it's essential to compare results with native protein extracted from Oryza sativa thylakoids as a reference standard for proper structure and function .

How does the redox state of the cellular environment influence PsbD synthesis and turnover?

The redox state plays a critical role in regulating PsbD synthesis and turnover through multiple mechanisms:

  • Translational regulation: The translation of psbD mRNA is influenced by the redox state of the chloroplast. Research shows that certain RNA-binding proteins associate with psbD mRNA in a light-dependent manner through redox-based mechanisms .

  • Assembly factor redox sensitivity: Proteins involved in PsbD assembly, such as LPE1, show redox-dependent activity. Under oxidizing conditions, these factors may undergo conformational changes that alter their ability to interact with psbD mRNA or other assembly components .

  • Damage and repair cycle: High light conditions generate reactive oxygen species that damage PsbD and other PSII components, triggering a redox-regulated repair cycle. The rate of D2 turnover increases under oxidative stress conditions.

  • Thiol regulation: Key cysteine residues in PsbD and its assembly factors can form reversible disulfide bonds depending on the redox environment, affecting protein stability and function.

Experimental approaches to study these effects include:

  • Thiol-trapping experiments to assess cysteine oxidation states

  • In vitro translation systems with controlled redox conditions

  • Analysis of PsbD synthesis under treatments with redox-active compounds

  • Site-directed mutagenesis of redox-sensitive residues

Understanding these redox-dependent mechanisms provides insight into how environmental conditions affect PSII maintenance and function.

What are the optimal conditions for studying PsbD turnover in vivo?

Studying PsbD turnover in vivo requires careful experimental design to capture accurate rates while minimizing artifacts:

  • Pulse-chase labeling protocols:

    • 35S-methionine labeling: Incorporate radioactive methionine for 15-30 minutes (pulse), followed by addition of excess non-radioactive methionine (chase).

    • Click chemistry approaches: Use non-canonical amino acids like L-azidohomoalanine followed by copper-catalyzed click reactions with fluorescent tags.

  • Light condition considerations:

    • Standard turnover: 100-150 μmol photons m−2 s−1, 16h/8h light/dark cycle

    • Accelerated turnover: 800-1200 μmol photons m−2 s−1 high light treatment

    • Photoinhibitory conditions: 1500-2000 μmol photons m−2 s−1 with low temperature (4°C)

  • Sampling timeline optimization:

Light ConditionRecommended Sampling Points (hours)Expected Half-life
Low light (50 μmol m−2 s−1)0, 8, 24, 48, 72>40 hours
Growth light (150 μmol m−2 s−1)0, 4, 8, 24, 4820-30 hours
High light (1000 μmol m−2 s−1)0, 1, 2, 4, 8, 242-8 hours
  • Protein synthesis inhibition approaches:

    • Lincomycin (chloroplast translation inhibitor) at 1-2 mM

    • Cycloheximide (cytosolic translation inhibitor) at 100-200 μg/ml as control

  • Detection methods:

    • Immunoblotting with anti-PsbD antibodies (e.g., rabbit polyclonal AS06 146)

    • Quantification using fluorescently-labeled secondary antibodies for greater linearity

When designing turnover experiments, it's crucial to consider that D2 and D1 turnover rates may be interdependent, as they form a heterodimer at the core of PSII .

How can researchers effectively distinguish between effects on PsbD synthesis versus degradation?

Distinguishing between synthesis and degradation effects requires specialized experimental approaches:

  • For synthesis assessment:

    • In vivo labeling: Use 35S-methionine pulse labeling for short periods (10-15 minutes) to monitor newly synthesized protein.

    • Polysome association analysis: Extract polysomes and analyze the association of psbD mRNA to determine translational activity.

    • Ribosome profiling: Sequence ribosome-protected mRNA fragments to assess translation efficiency.

  • For degradation assessment:

    • Chase experiments: After labeling, track the disappearance of labeled protein.

    • Inhibitor studies: Use lincomycin to block chloroplast translation, then monitor protein decline.

    • Proteolytic fragment analysis: Identify and quantify specific degradation products.

  • Integrated approaches:

    • Dual isotope labeling: Use different isotopes at different times to simultaneously track synthesis and degradation.

    • Mathematical modeling: Apply kinetic models to experimental data to calculate synthesis and degradation rates.

Experimental QuestionRecommended ApproachControl/Validation
Is translation initiation affected?Polysome loading analysisCompare multiple chloroplast transcripts
Is elongation rate altered?Ribosome profilingUse translation elongation inhibitors as reference
Is protein degradation accelerated?Chase experiments with synthesis inhibitionCompare to a reference protein with known stability
Are both processes affected?Dual labeling + mathematical modelingVerify with genetic approaches

When using these approaches with recombinant systems, researchers should be aware that the absence of the complete PSII assembly machinery may alter normal degradation pathways .

What genetic approaches can be used to study PsbD function in Oryza sativa?

Several genetic approaches provide valuable insights into PsbD function in rice:

  • CRISPR/Cas9 genome editing:

    • Creating specific mutations in the psbD gene to study structure-function relationships

    • Targeting regulatory elements affecting psbD expression

    • Engineering precise modifications to study post-translational modification sites

  • RNA interference (RNAi) and antisense approaches:

    • Knockdown of nuclear-encoded factors involved in psbD expression and D2 assembly

    • Targeted reduction of PsbD levels to study dosage effects

    • Temporal control using inducible promoters

  • Chloroplast transformation:

    • Site-directed mutagenesis of the chloroplast psbD gene

    • Introduction of tagged versions for in vivo tracking

    • Complementation studies with heterologous psbD variants

  • Overexpression studies:

    • Expression of additional copies of assembly factors

    • Introduction of modified versions resistant to degradation

    • Co-expression of interacting partners

  • T-DNA insertion mutant screening:

    • Identifying nuclear genes affecting PsbD expression and function

    • Studying regulatory networks controlling D2 synthesis

The assessment of these genetic modifications typically involves a combination of:

  • Chlorophyll fluorescence measurements to evaluate PSII function

  • Immunoblot analysis to determine protein levels

  • Electron microscopy to assess thylakoid structure

  • Growth and development phenotyping under various light conditions

When designing genetic studies, researchers should consider that complete loss of PsbD function is likely lethal, necessitating conditional or partial loss-of-function approaches .

What analytical techniques best characterize the interaction between recombinant PsbD and photosynthetic pigments?

Characterizing PsbD-pigment interactions requires specialized techniques to understand binding properties, stoichiometry, and functional implications:

  • Spectroscopic analyses:

    • Absorption spectroscopy: Measures pigment binding through characteristic absorption peaks

    • Circular dichroism (CD): Detects changes in pigment organization within protein environment

    • Resonance Raman spectroscopy: Provides vibrational information about bound pigments

    • Time-resolved fluorescence: Measures energy transfer dynamics between pigments

  • Biochemical approaches:

    • HPLC analysis of extracted pigments to determine bound pigment composition

    • Size exclusion chromatography to assess protein-pigment complex formation

    • Native electrophoresis combined with second-dimension separation to analyze complexes

  • Structural methods:

    • Single-particle cryo-electron microscopy to visualize pigment binding sites

    • X-ray crystallography for high-resolution structural analysis

    • NMR spectroscopy for dynamic information about pigment-protein interactions

TechniqueInformation ProvidedAdvantagesLimitations
Absorption spectroscopyPigment binding, environmentSimple, non-destructiveLimited structural information
CD spectroscopyPigment-protein interactionsSensitive to conformational changesRequires careful interpretation
HPLC analysisPigment identity, stoichiometryQuantitative, specificDestructive, may lose weakly bound pigments
Cryo-EMStructural organizationDirect visualizationRequires homogeneous samples

When working with recombinant PsbD, it's essential to verify that pigment binding properties match those of the native protein, as expression systems may lack appropriate pigment synthesis pathways or assembly factors .

How does Oryza sativa PsbD compare structurally and functionally to PsbD proteins from other photosynthetic organisms?

Comparative analysis of PsbD proteins across species reveals both conservation and adaptation:

  • Sequence conservation:

    • Core functional domains show >90% sequence identity across higher plants

    • Transmembrane regions display highest conservation

    • Stromal and lumenal loop regions show greater variability

  • Structural comparison:

OrganismPsbD Size (aa)Key Structural DifferencesFunctional Implications
Oryza sativa353Rice-specific N-terminal residuesPotential adaptation to high light environments
Arabidopsis thaliana353Nearly identical to riceSimilar function in dicots
Chlamydomonas reinhardtii352Altered quinone binding pocketDifferent herbicide sensitivity
Synechocystis sp.344Shorter connecting loopsAdaptation to prokaryotic thylakoid organization
Red algae351Modified chlorophyll binding sitesAdaptation to different light harvesting systems
  • Functional differences:

    • Thermostability variations correlate with species' native environments

    • Differential susceptibility to photoinhibition

    • Species-specific interactions with varying light-harvesting antenna systems

  • Evolutionary conservation:

    • Redox-active cofactor binding sites show highest conservation

    • Quinone binding pocket residues are nearly invariant

    • Dimerization interface with D1 is highly conserved

This comparative knowledge is valuable when designing experiments with heterologous systems or interpreting cross-species antibody reactivity. For example, the rabbit polyclonal antibody AS06 146 has been validated as a "global antibody" that recognizes PsbD across diverse species including rice, Arabidopsis, cyanobacteria, and algae .

What insights can be gained from studying PsbD mutations and their effects on photosystem II function?

Mutational analysis of PsbD provides critical insights into structure-function relationships:

  • Functional domain mapping:

    • Mutations in transmembrane helices 4 and 5 disrupt quinone binding

    • Alterations to the redox-active tyrosine (YD) affect electron transfer kinetics

    • Mutations at the interface with D1 disrupt dimer formation and PSII assembly

  • Disease-relevant mutations:

    • Naturally occurring mutations in Oryza sativa and other crop plants have been linked to photosensitivity phenotypes

    • Certain mutations confer herbicide resistance with potential agronomic applications

  • Experimental approaches:

Mutation CategoryExperimental ApproachPhenotypic Assessment
Point mutationsSite-directed mutagenesisElectron transfer kinetics, oxygen evolution
Domain swappingChimeric protein constructionAssembly efficiency, partner protein interactions
Deletion analysisTruncation constructsMinimal functional domains, assembly requirements
Random mutagenesisError-prone PCRIdentification of critical residues
  • Key findings from mutation studies:

    • Residues involved in herbicide binding have been precisely mapped

    • The importance of specific amino acids in maintaining the water-splitting complex

    • Identification of regions critical for photoprotection

  • Challenges in mutation studies:

    • Lethality of many mutations necessitating conditional expression systems

    • Distinguishing direct effects from assembly/stability consequences

    • Need for complementary biochemical and biophysical analyses

Mutational studies are particularly valuable when combined with structural information, allowing researchers to correlate atomic-level details with functional outcomes in vivo .

What are the most informative spectroscopic methods for characterizing recombinant PsbD properties?

Advanced spectroscopic techniques provide critical insights into PsbD structure, function, and dynamics:

  • Electronic spectroscopy techniques:

    • UV-visible absorption spectroscopy: Identifies pigment binding through characteristic absorption bands

    • Circular dichroism (CD): Assesses protein secondary structure and pigment organization

    • Fluorescence spectroscopy: Monitors chlorophyll binding and energy transfer

  • Magnetic resonance methods:

    • Electron paramagnetic resonance (EPR): Detects paramagnetic species like YD- radical

    • Nuclear magnetic resonance (NMR): Provides structural information about specific labeled regions

    • ENDOR/ESEEM: Offers detailed information about the electronic structure of redox cofactors

  • Vibrational spectroscopy:

    • FTIR difference spectroscopy: Tracks subtle conformational changes during function

    • Resonance Raman spectroscopy: Provides information about pigment-protein interactions

    • Surface-enhanced Raman spectroscopy: Enhances signal for low-abundance samples

TechniqueInformation ObtainedSample RequirementsLimitations
EPRRedox active cofactor environmentFrozen samples (77K or lower)Limited to paramagnetic species
FTIRProtein secondary structure, ligand bindingHighly concentrated samplesWater interference
Resonance RamanPigment-protein interactionsLaser excitation matched to absorptionSample photodamage concerns
Time-resolved fluorescenceEnergy transfer ratesIntact complexesComplex data interpretation
  • Time-resolved techniques:

    • Transient absorption spectroscopy: Tracks electron transfer events in real-time

    • Time-resolved fluorescence: Measures excitation energy transfer dynamics

    • Time-resolved EPR: Monitors radical pair formation and decay

When applying these techniques to recombinant PsbD, researchers should benchmark results against native PSII complexes to ensure functional relevance .

How can researchers effectively reconstitute recombinant PsbD into membrane systems for functional studies?

Reconstitution of recombinant PsbD into membrane environments is critical for functional studies and requires careful methodological considerations:

  • Selection of membrane mimetics:

Membrane SystemAdvantagesDisadvantagesBest Applications
LiposomesNative-like bilayer, controllable compositionSize heterogeneity, internal volumeElectron transfer studies
NanodiscsDefined size, accessible from both sidesComplex assembly, limited diameterStructural studies, controlled oligomerization
BicellesAlignment capabilities for NMRLimited stabilityNMR structural studies
ProteoliposomesGood for multi-protein complexesChallenging orientation controlFunctional assays requiring transmembrane gradients
  • Reconstitution protocols:

    • Detergent-mediated reconstitution: Solubilized protein mixed with lipids, followed by detergent removal

    • Direct incorporation during protein synthesis: Cell-free expression in the presence of liposomes

    • Spontaneous insertion: Applicable for certain membrane scaffold proteins with recombinant PsbD

  • Optimization parameters:

    • Lipid composition: MGDG:DGDG:SQDG:PG ratios mimicking thylakoid membranes

    • Protein:lipid ratio: Typically 1:100-1:1000 (w/w) depending on application

    • Reconstitution buffer: Osmotically balanced with required cofactors

  • Functional verification:

    • Orientation analysis: Protease accessibility assays to confirm proper topology

    • Cofactor binding: Spectroscopic assessment of chlorophyll and carotenoid incorporation

    • Electron transfer capability: EPR or optical spectroscopy measurements with electron donors/acceptors

  • Co-reconstitution approaches:

    • Sequential addition of components based on the natural assembly pathway

    • Inclusion of assembly factors to facilitate proper complex formation

    • Co-expression of multiple components in cell-free systems

The choice of reconstitution method should be guided by the specific experimental questions and downstream analytical techniques .

What are common pitfalls in recombinant PsbD expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant PsbD protein:

  • Expression yield issues:

ProblemPossible CausesSolutions
Low expressionToxicity to host, inefficient translationUse tightly regulated promoters, optimize codon usage
Inclusion body formationImproper folding, high expression rateLower induction temperature, use solubility tags
Protein degradationProtease sensitivityAdd protease inhibitors, use protease-deficient strains
Truncated productsPremature termination, internal start sitesOptimize rare codons, modify potential internal RBS
  • Membrane integration problems:

    • Symptom: Protein found primarily in cytoplasmic fraction

    • Solution: Co-express with membrane integration facilitators, use signal sequences optimized for membrane proteins

  • Pigment binding issues:

    • Symptom: Lack of characteristic spectroscopic signatures

    • Solution: Supplement growth media with chlorophyll precursors, co-express chlorophyll biosynthesis genes

  • Protein detection challenges:

    • Symptom: Weak signal in Western blots despite expression

    • Solution: Optimize extraction conditions, use multiple epitope tags, verify antibody reactivity with denatured protein

  • Purification difficulties:

    • Symptom: Co-purification of contaminants, low recovery

    • Solution: Use tandem affinity tags, optimize detergent selection, employ size exclusion as a final step

When troubleshooting expression issues, a systematic approach varying multiple parameters (temperature, induction time, host strain, media composition) is recommended to identify optimal conditions .

How can researchers verify that recombinant PsbD protein retains native structure and function?

Verifying the structural and functional integrity of recombinant PsbD requires multiple complementary approaches:

  • Structural verification:

    • Circular dichroism (CD): Compare secondary structure profiles with native protein

    • Limited proteolysis: Analyze digestion patterns to assess structural similarities

    • Thermal stability assays: Measure unfolding transitions using differential scanning calorimetry

  • Functional assessment:

    • Cofactor binding: Measure chlorophyll and β-carotene association spectroscopically

    • Electron transfer capabilities: Monitor redox activity using artificial electron donors/acceptors

    • Interaction with partner proteins: Verify binding to D1 and other PSII components

  • Comparative benchmarking:

ParameterNative PsbDRecombinant PsbD (Optimal)Recombinant PsbD (Compromised)
α-helical content60-65%55-65%<50%
Chlorophyll binding100%>80%<50%
Thermal stability (Tm)65-70°C60-65°C<55°C
D1 interactionHigh affinityDetectable bindingWeak/no binding
YD- formationReadily detectablePresent but may be reducedAbsent
  • Reconstitution tests:

    • Assembly capability: Ability to form higher-order complexes with other PSII components

    • Function in proteoliposomes: Electron transfer or energy transfer measurements

    • Complementation studies: Ability to restore function in mutant systems

When validating recombinant protein, it's important to recognize that partial functionality may be sufficient for certain applications (e.g., structural studies) but inadequate for others (e.g., detailed kinetic analyses) .

What emerging technologies hold promise for advancing PsbD structure-function research?

Several cutting-edge technologies are poised to transform our understanding of PsbD:

  • Advanced structural methods:

    • Cryo-electron tomography: Visualizing PSII in its native membrane environment

    • Microcrystal electron diffraction (MicroED): Determining structures from nanoscale crystals

    • Serial femtosecond crystallography: Capturing dynamic states during function

  • Single-molecule techniques:

    • Single-molecule FRET: Measuring conformational changes during function

    • Optical tweezers combined with fluorescence: Correlating mechanical properties with functional states

    • Single-molecule mass spectrometry: Analyzing individual protein complexes

  • Synthetic biology approaches:

    • De novo design of simplified photosystems: Creating minimal functional units

    • Non-canonical amino acid incorporation: Introducing spectroscopic probes at specific sites

    • Orthogonal translation systems: Expanding the chemical diversity of PsbD

  • Computational methods:

    • Molecular dynamics simulations: Modeling dynamics at atomic resolution

    • Machine learning for protein design: Predicting functional variants

    • Quantum mechanical/molecular mechanical (QM/MM) calculations: Accurate modeling of electronic processes

These technologies promise to address longstanding questions about PsbD function, including:

  • The precise sequence of electron transfer events

  • How protein dynamics facilitate water oxidation

  • The molecular mechanisms of photoprotection and photodamage

  • The assembly pathway of functional PSII complexes

What are the most significant unresolved questions regarding PsbD protein in photosynthesis research?

Despite decades of research, several fundamental questions about PsbD remain unanswered:

  • Assembly and turnover dynamics:

    • How is PsbD synthesis coordinated with D1 and other PSII components?

    • What determines the selective degradation of damaged PsbD?

    • How do assembly factors recognize and bind newly synthesized PsbD?

  • Structural dynamics during function:

    • What conformational changes occur during the S-state transitions of water oxidation?

    • How does electron transfer trigger protonation changes?

    • What is the molecular basis for photoprotection mechanisms?

  • Regulatory mechanisms:

    • How is light-dependent translation of psbD mRNA regulated at the molecular level?

    • What determines the stability of PsbD under different environmental conditions?

    • How do post-translational modifications affect PsbD function?

  • Species-specific adaptations:

    • How have subtle sequence variations in PsbD contributed to environmental adaptation?

    • What determines differential sensitivity to photoinhibition across species?

    • How do interaction networks around PsbD vary between organisms?

  • Applied research frontiers:

    • Can engineered PsbD variants improve photosynthetic efficiency?

    • How might PsbD modifications enhance stress resistance in crop plants?

    • Can recombinant PsbD be utilized in artificial photosynthetic systems?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, biophysics, molecular genetics, and computational modeling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.