Recombinant Oryza sativa Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The D1 protein is indispensable for PSII biogenesis and repair:

  • Electron Transport: Binds plastoquinone (Q<sub>B</sub>) at the PSII reaction center, enabling electron transfer from water to plastoquinone .

  • Light-Dependent Regulation: Synthesis of D1 is tightly regulated by light via redox-sensitive mechanisms. Studies in Arabidopsis homologs (e.g., LPE1) show that light activates psbA mRNA translation, ensuring efficient D1 production under varying light conditions .

  • Chloroplast Development: Mutations in psbA or its regulators (e.g., cpSRP43) lead to chlorophyll deficiency, impaired chloroplast ultrastructure, and reduced photosynthetic efficiency .

Expression and Purification

The recombinant protein is produced in heterologous systems (e.g., E. coli) for biochemical studies:

  • Purity: >90% as confirmed by SDS-PAGE .

  • Applications: Used in ELISA, enzyme activity assays, and structural studies to investigate PSII function .

Mutational Studies

  • Premature Stop Codons: A single base substitution (A→T) in OscpSRP43, a D1 chaperone, causes truncated protein formation, leading to chlorophyll deficiency and disrupted chloroplast development in rice .

  • Gene Expression: Dysregulation of psbA and related genes (e.g., HEMA1, PORA) alters chlorophyll biosynthesis and PSII activity .

Comparative Analysis with Homologs

OrganismProteinFunctionPhenotype of Mutants
Oryza sativa (Rice)Photosystem Q(B)PSII reaction center; electron transportYellow-green leaves, reduced photosynthesis
Arabidopsis thalianaLPE1Binds psbA mRNA 5′ UTR; regulates D1 translationReduced PSII activity, impaired growth
Chlamydomonas reinhardtiiCrcpSRP43Chaperone for D1 integration into thylakoidsHigh Chl a/b ratio, yellow-green phenotype

Applications and Future Directions

  • Biotechnological Engineering: Overexpression of psbA or its regulators could enhance photosynthetic efficiency in crops .

  • Environmental Stress Studies: Used to analyze PSII resilience under high light or oxidative stress .

  • Drug Discovery: Target for herbicides that inhibit PSII (e.g., diuron) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; PA001; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Oryza sativa (Rice)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several downstream electron acceptors.
Database Links

KEGG: osa:3131409

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the QB binding site in Oryza sativa PSII?

The QB binding site in rice is located within the D1 protein of Photosystem II. The D1 protein consists of five transmembrane α-helices, named A–E, which are positioned in close proximity to the D2 protein . The QB pocket is highly conserved among photosynthetic organisms, including cyanobacteria, algae, and plants . At the bottom of the QB pocket, specific polar groups of amino acids such as His215, Ser264, and/or Phe265 form hydrogen bonds with the keto-oxygens of the plastoquinone (PQ) head . These amino acid residues are highly conserved among oxygenic photosynthetic organisms, suggesting evolutionary importance in maintaining photosynthetic function .

Methodologically, researchers investigating this structure should employ molecular modeling approaches based on crystal structures, with the understanding that while direct structures from cyanobacteria (e.g., T. elongatus) are available at 3.2 Å resolution, plant-specific structures require careful homology modeling due to limited direct structural data from plant PSII-herbicide complexes .

How does the QB protein of rice compare with those of wild relatives in terms of photochemical efficiency?

Comparative analyses between cultivated rice varieties and wild rice species reveal significant variations in photochemical efficiency parameters directly related to QB protein function. Wild rice species such as O. australiensis and O. latifolia demonstrate higher quantum efficiency of Photosystem II (Fv/Fm values of approximately 0.83) compared to cultivated O. sativa varieties (typically ranging from 0.73 to 0.80) . Additionally, wild rice species exhibit higher values for other photochemical parameters including:

SpeciesFv/FmφPSIIPhotochemical quenching (qP)Electron transport rate (ETR)
O. australiensis (Wild)0.83HigherHigherHigher
O. latifolia (Wild)0.83HigherHigherHigher
O. glaberrima (African cultivated)0.82ModerateModerateModerate
O. sativa cultivars0.73-0.80LowerLowerLower

These parameters strongly correlate with net photosynthesis rates (PN), with correlation coefficients of r=0.789 for Fv/Fm, r=0.981 for φPSII, r=0.980 for qP, and r=0.981 for ETR . These findings indicate that the photochemical properties of the QB site in wild rice species contribute significantly to their higher photosynthetic efficiency.

What are the established protocols for analyzing QB site functionality in recombinant Oryza sativa PSII proteins?

Two primary experimental approaches are well-established for evaluating QB site functionality in recombinant rice PSII proteins:

  • DPIP Photoreduction Assay: This spectrophotometric method measures the rate of DPIP (2,6-dichlorophenolindophenol) reduction as an indicator of electron flow through PSII . The assay provides quantitative measurement of QB site function and can be used to determine inhibition constants (I50) for various compounds interacting with the QB binding site .

  • OJIP Fluorescence Transient Analysis: This non-invasive technique measures chlorophyll fluorescence induction kinetics, providing information about electron transport from the donor side of PSII through the QB site to downstream acceptors . The OJIP test yields multiple parameters that reflect the efficiency of different steps in the photosynthetic electron transport chain .

For researchers studying recombinant QB proteins, it's critical to isolate thylakoid membranes under conditions that preserve native protein conformation. Protocols typically involve buffer systems containing 0.4 M sucrose, 15 mM NaCl, 5 mM MgCl2, and 50 mM Hepes-KOH (pH 7.5) . Comparative analysis between native and recombinant systems should account for potential differences in protein folding and membrane integration.

How can researchers effectively measure binding affinities of compounds to the recombinant QB site?

To measure binding affinities of various compounds (e.g., herbicides, modified quinones) to the recombinant QB site of rice PSII, researchers should implement a multi-faceted approach:

  • Fluorescence-Based Inhibition Studies: By measuring the inhibition of electron transport using OJIP fluorescence transients, researchers can calculate I50 values (concentration causing 50% inhibition) . For example, studies with native pea thylakoids showed that diuron, terbuthylazine, and metribuzin have I50 values an order of magnitude lower (indicating higher affinity) than bentazon and metobromuron .

  • Molecular Docking and Free Energy Calculations: Computational approaches can predict binding energies and interaction networks between the recombinant QB site and ligands . These should be validated with experimental data from binding studies.

  • Direct Binding Assays: Using radiolabeled or fluorescent-tagged ligands to measure displacement curves and determine dissociation constants (Kd).

When analyzing data, researchers should consider that modifications to recombinant proteins may alter binding properties compared to the native protein, necessitating careful controls and validation against native systems.

How does nitrogen deficiency affect the function of the QB site in rice PSII?

Nitrogen deficiency significantly impairs electron transport through the QB site of rice PSII, affecting the entire photosynthetic apparatus. Under nitrogen-limiting conditions, several key changes occur:

  • Increased minimum fluorescence (F0) and decreased maximum quantum yield of primary photochemistry (Fv/Fm) . Under severe nitrogen deficiency, Fv/Fm decreases by approximately 15.6% compared to control conditions .

  • Decreased efficiency of electron transport beyond QA (primary quinone acceptor), as evidenced by increased values of relative variable fluorescence at the J-step (Vj) .

  • Reduced electron transport per cross-section (ET0/CS0) and decreased re-reduction of end acceptors of PSI per cross-section (Re0/CS0) .

  • Decreased total performance index (PItotal), indicating comprehensive impairment of PSII-PSI electron transport .

These parameters collectively demonstrate that nitrogen deficiency disrupts the QB site function, impairing electron flow from the donor side of PSII through to the end acceptors of PSI . Researchers working with recombinant QB proteins should consider carefully controlling nitrogen availability in their expression systems to ensure proper protein structure and function.

What changes occur in QB site proteins during salt stress in Oryza sativa?

Proteomic analysis of rice under salt stress reveals significant changes in the abundance and post-translational modifications of proteins associated with photosynthetic complexes, including those related to the QB binding site. Using iTRAQ-based quantitative proteomics, the following changes have been observed:

ProteinAccessionCoverage (%)Fold Change Under Salt Stress
Chloroplast PSI reaction center subunit II precursor-like (PsaD)gi|2936739114.81.585 (increased)
Photosystem-1 H subunit GOS5 (PsaH)gi|38858947.70.624 (decreased)
Chlorophyll a/b-binding protein precursor (Lhca1)gi|37899545.40.581 (decreased)
Putative photosystem I antenna protein (Lhca2)gi|3439351116.30.635 (decreased)
Chlorophyll a/b-binding protein precursor (Lhca4)gi|378995220.10.549 (decreased)

While this data primarily shows changes in PSI components, the interconnected nature of PSI and PSII, particularly in terms of electron transport through the QB site, suggests that salt stress significantly alters the stoichiometry and function of the photosynthetic apparatus . For researchers working with recombinant QB proteins, understanding these stress responses is crucial for interpreting experimental results under varying conditions.

How conserved is the QB binding site across different rice species and varieties?

Comparative analysis of the QB binding site across rice species reveals a high degree of conservation at the amino acid level, reflecting its crucial role in photosynthesis. Based on structural data from cyanobacteria (T. elongatus) and sequence alignments with rice varieties, key residues forming the QB niche (including His215, Ser264, and Phe265) show remarkable conservation among cyanobacteria, algae, and plants .

For researchers working with recombinant QB proteins, considering the specific rice variety as a source for the recombinant protein is crucial, as these subtle differences may impact experimental outcomes, particularly in studies related to photosynthetic efficiency or herbicide binding.

What structural differences exist between the QB binding sites of rice and cyanobacterial PSII?

While the QB binding site is highly conserved across photosynthetic organisms, certain structural differences exist between rice and cyanobacterial PSII that may influence protein function and ligand interactions:

  • Amino Acid Composition: Although key residues are conserved, surrounding amino acids that influence the electrostatic environment and accessibility of the QB pocket may differ between rice and cyanobacteria.

  • Membrane Environment: The thylakoid membrane composition differs between plants and cyanobacteria, potentially affecting protein dynamics and accessibility of the QB site.

  • D1 Protein Isoforms: Rice possesses multiple D1 protein isoforms that are differentially expressed under various environmental conditions, whereas cyanobacteria typically have fewer isoforms .

These differences must be considered when extrapolating findings from cyanobacterial crystal structures (such as the 3.2 Å resolution structure of terbutryn-bound PSII from T. elongatus) to rice PSII . Molecular modeling approaches that account for these differences are essential for accurate structure-function analyses of the rice QB site.

How can site-directed mutagenesis of the QB binding site be used to study herbicide resistance in rice?

Site-directed mutagenesis of the QB binding site offers a powerful approach for studying herbicide resistance mechanisms in rice. Based on the understanding that herbicides like diuron, terbuthylazine, and metribuzin compete with plastoquinone for binding at the QB site , researchers can implement the following methodological approach:

  • Target Residue Selection: Identify specific amino acids in the QB pocket that interact directly with herbicides. Primary candidates include His215, Ser264, and Phe265, which are known to form hydrogen bonds with the keto-oxygens of plastoquinone and also interact with herbicides like terbutryn .

  • Rational Design of Mutations: Create mutations that alter herbicide binding while preserving plastoquinone binding and electron transport function. Consider both the chemical nature of the substitution (e.g., polarity, size) and its position within the binding pocket.

  • Functional Assays: Assess the impact of mutations on both herbicide binding (using inhibition assays with DPIP photoreduction or OJIP fluorescence) and PSII function (measuring electron transport rates and quantum efficiency) .

  • Molecular Dynamics Simulations: Complement experimental data with computational analyses to understand how mutations affect the binding energetics and interaction networks within the QB site .

This approach has significant implications for developing herbicide-resistant rice varieties and understanding the molecular basis of acquired herbicide resistance in weeds.

What approaches can be used to enhance electron transport through the QB site for improved photosynthetic efficiency in rice?

  • Genetic Engineering of D1 Protein: Targeted modifications of the D1 protein sequence based on naturally occurring variations in wild rice species with superior photochemical efficiency (O. australiensis, O. latifolia) . Focus on regions that influence the redox properties of the QB site and electron transfer kinetics.

  • Optimization of Plastoquinone-Binding Dynamics: Modifications that enhance the exchange rate of plastoquinone/plastoquinol at the QB site without compromising binding affinity.

  • Environmental Optimization: Implement precise control of nitrogen availability, as nitrogen deficiency significantly impairs electron transport through the QB site . Quantitative analysis shows that severe nitrogen deficiency decreases Fv/Fm by 15.6% and increases energy dissipation (DI0/CS0) by 128% .

  • Anatomical Considerations: Account for the relationship between leaf anatomy and photosynthetic efficiency. Wild rice species with efficient electron transport typically have larger mesophyll cells with more chloroplasts, which may influence the density and arrangement of PSII complexes .

For recombinant protein studies, these approaches can be explored through in vitro reconstitution experiments using modified QB site proteins in artificial membrane systems.

What are the key considerations for expressing and purifying functional recombinant Oryza sativa QB proteins?

Expressing and purifying functional recombinant QB proteins from rice presents several significant challenges:

  • Maintaining Membrane Protein Structure: The D1 protein containing the QB site is a highly hydrophobic membrane protein with multiple transmembrane domains . Expression systems must provide appropriate membrane environments or detergent micelles to maintain proper folding.

  • Cofactor Assembly: Ensure proper integration of cofactors necessary for electron transport, including the plastoquinone molecule that binds at the QB site.

  • Protein Stability: The D1 protein is susceptible to light-induced damage and rapid turnover in vivo. Purification protocols must minimize exposure to light and oxidative conditions that could compromise protein integrity.

  • Functional Verification: Implement multiple assays to verify that the recombinant protein maintains native-like electron transport properties. OJIP fluorescence measurements can verify functionality when the recombinant protein is reconstituted into liposomes or nanodiscs .

Researchers should consider using specialized expression systems developed for membrane proteins, such as cell-free systems supplemented with lipids or expression in host organisms capable of properly inserting complex membrane proteins.

How can researchers address data inconsistencies when comparing in vitro and in vivo studies of QB site function?

When comparing in vitro studies using recombinant QB proteins with in vivo data from intact plants or thylakoids, researchers frequently encounter inconsistencies that require careful methodological consideration:

  • Membrane Environment Differences: The artificial membrane or detergent environment of recombinant proteins differs significantly from the native thylakoid membrane. Researchers should attempt to reconstitute proteins in liposomes with lipid compositions mimicking thylakoid membranes.

  • Protein-Protein Interaction Networks: In vivo, the D1 protein interacts with numerous other photosynthetic components that may be absent in recombinant systems. Consider co-expressing key interaction partners or using techniques like native mass spectrometry to verify protein complex formation.

  • Redox Environment Control: The redox potential influences electron transport at the QB site. Ensure comparable redox conditions between in vitro and in vivo experiments by carefully controlling buffer components and measuring actual redox potentials.

  • Standardizing Measurement Techniques: Use identical protocols for functional measurements (e.g., OJIP parameters) across systems. For example, when comparing fluorescence parameters, standardize measuring conditions including dark adaptation time, light intensity, and temperature .

  • Statistical Validation: Implement robust statistical analyses to determine whether observed differences are significant or within the expected variation range. Report confidence intervals and p-values when comparing parameters between systems.

By systematically addressing these considerations, researchers can develop more reliable correlations between in vitro and in vivo studies, enhancing the translational value of recombinant protein research.

How might CRISPR-Cas9 technology be applied to study QB site function in rice?

CRISPR-Cas9 genome editing offers unprecedented opportunities for studying QB site function directly in rice plants through precise genetic modifications:

  • Targeted D1 Protein Modifications: Create specific amino acid substitutions in the QB binding pocket to test hypotheses about structure-function relationships. Priority targets include the highly conserved His215, Ser264, and Phe265 residues known to interact with plastoquinone and herbicides .

  • Promoter Modifications: Modify the expression levels or patterns of D1 protein isoforms to investigate how D1 protein abundance affects PSII assembly and function under different environmental conditions.

  • Introduction of Tagged Variants: Insert epitope tags or fluorescent protein fusions at non-critical regions of the D1 protein to facilitate in vivo tracking of protein dynamics and turnover.

  • Creation of Rice Lines with Variant QB Sites from Wild Relatives: Transfer specific QB site configurations from wild rice species with superior photochemical efficiency (e.g., O. australiensis, O. latifolia) into cultivated varieties to test their impact on photosynthetic performance .

Researchers implementing CRISPR-Cas9 approaches should develop high-throughput screening methods using chlorophyll fluorescence imaging to rapidly assess the impact of genetic modifications on PSII function in planta.

What are the prospects for developing synthetic QB analogs that could enhance photosynthetic efficiency in rice?

The development of synthetic QB analogs represents an innovative frontier in photosynthesis research with potential applications for enhancing crop productivity:

  • Rational Design Approach: Based on the structure of the QB binding site and natural plastoquinone, design synthetic molecules with:

    • Optimized redox potentials to facilitate electron transfer

    • Enhanced binding/unbinding kinetics to increase the rate of QB site turnover

    • Improved stability against oxidative damage

  • Screening Methodology: Develop high-throughput screening systems using isolated thylakoids or recombinant D1 proteins to test libraries of potential QB analogs. Primary screening can utilize OJIP fluorescence transients to assess electron transport efficiency .

  • Delivery Systems: Research methods for introducing synthetic QB analogs into plant cells, possibly through:

    • Lipid nanoparticles capable of fusing with thylakoid membranes

    • Conjugation with cell-penetrating peptides

    • Genetic engineering of plastoquinone biosynthesis pathways

  • Validation in Intact Plants: Verify that synthetic QB analogs enhance photosynthetic parameters in vivo, measuring key performance indicators such as Fv/Fm, φPSII, qP, and ETR, which strongly correlate with net photosynthesis (correlation coefficients r>0.78) .

This research direction combines aspects of synthetic biology, nanomaterials science, and photosynthesis research, requiring interdisciplinary collaboration for successful implementation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.