Recombinant Oryza sativa subsp. indica 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice is required for dry ice shipping, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
HMG1; OsI_008506; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; HMG-CoA reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
HMG1
Target Protein Sequence
MDVRRGGGGGRIVGAARRALTWGALPLPMRITNGLAMVSLVLSSCDLLRLCSDRERPLGG REFATVVCQLASVVYLLSLFAHPDAPATTTGDDDDGQGGSRRARPAAAEPAPMHGHGGGM MEADDEEIVAAVASGALPSHRLESRLGDCRRAARLRREALRRVTGRGVEGLPFDGMDYQA ILGQCCEMPVGYVQLPVGVAGPLLLDGREYHVPMATTEGCLVASVNRGCRAISASGGAFS VLLRDAMSRAPAVKLPSAMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGR NLYMRFSCITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEG RGKSVVCEAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALF IATGQDPAQNVESSQCITMLEEVDDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLG VKGSNHGSPGANAKRLATIVAGSVLAGELSLLAALASGHLVKSHMMYNRSSKDVAKAAS
Uniprot No.

Target Background

Function

Function: Catalyzes the synthesis of mevalonate, a precursor for all isoprenoid compounds in plants.

Database Links
Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does rice HMG1 compare to HMG-CoA reductases from other plant species?

Rice HMG1 shares significant sequence homology with other plant HMG-CoA reductases, particularly within the catalytic domain. While mammals typically possess a single HMGR gene, plants often contain multiple isoforms with tissue-specific expression patterns. The rice enzyme contains the characteristic conserved domains found in other plant HMGRs, including the membrane-spanning regions and the catalytic domain.

Unlike some other regulatory proteins in rice such as AHL family members that have undergone significant diversification (with 20 AHL genes identified in rice compared to 29 in Arabidopsis) , the fundamental catalytic mechanism of HMG1 remains highly conserved across species. This evolutionary conservation reflects the enzyme's critical role in the mevalonate pathway, which is essential for isoprenoid biosynthesis in plants.

What are the optimal conditions for expression and purification of recombinant rice HMG1?

Based on successful protein production protocols, recombinant rice HMG1 can be optimally expressed and purified using the following methodology:

Expression System:

  • Host: E. coli expression system (BL21 or similar strains)

  • Vector: pET series with N-terminal His tag

  • Induction: 0.5-1.0 mM IPTG at OD600 = 0.6-0.8

  • Temperature: 18-25°C for 16-20 hours (to minimize inclusion body formation)

Purification Protocol:

  • Cell lysis using sonication in Tris/PBS-based buffer (pH 8.0)

  • Clarification by centrifugation (15,000 × g, 30 min)

  • Nickel affinity chromatography using His-tag

  • Size exclusion chromatography for highest purity

  • Final product should be lyophilized with 6% trehalose as a stabilizing agent

Storage and Handling:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (recommended: 50%)

  • Store working aliquots at 4°C for up to one week

  • Long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

What assays can be used to accurately measure rice HMG1 enzymatic activity?

The following methodological approaches provide reliable measurement of rice HMG1 activity:

Spectrophotometric Assay:

  • Principle: Monitor NADPH oxidation at 340 nm

  • Reaction mixture: HMG-CoA, NADPH, buffer (pH 7.0-7.5), and purified enzyme

  • Temperature: 30°C for rice enzymes

  • Controls: Heat-inactivated enzyme as negative control

Radiochemical Assay:

  • Principle: Measure conversion of [14C]-HMG-CoA to [14C]-mevalonate

  • Extraction: Organic phase separation of products

  • Detection: Liquid scintillation counting

  • Advantage: Higher sensitivity than spectrophotometric methods

HPLC-MS Based Assay:

  • Principle: Direct quantification of mevalonate production

  • Sample preparation: Reaction quenching with methanol followed by centrifugation

  • Analysis: Reverse-phase HPLC coupled with mass spectrometry

  • Advantage: Allows simultaneous analysis of multiple reaction intermediates

When conducting activity assays, it's critical to maintain reducing conditions (typically with DTT or β-mercaptoethanol) to preserve enzyme activity, as oxidation of critical cysteine residues can inactivate the enzyme.

How can site-directed mutagenesis approaches be used to study structure-function relationships in rice HMG1?

Site-directed mutagenesis provides powerful insights into structure-function relationships of rice HMG1. The following methodological framework is recommended:

Key Residues for Mutation Analysis:

  • Catalytic residues (identified through sequence alignment with characterized HMGRs)

  • NADPH binding site residues

  • HMG-CoA binding residues

  • Membrane-spanning domain residues

  • Potential regulatory phosphorylation sites

Mutagenesis Protocol:

  • Use QuikChange or similar PCR-based methods

  • Create single, double, and combinatorial mutations

  • Express in E. coli system similar to wild-type protein

  • Purify using identical protocols to ensure comparability

Functional Analysis:

  • Determine kinetic parameters (Km, kcat, kcat/Km) for each mutant

  • Compare thermal stability using differential scanning fluorimetry

  • Assess protein-substrate interactions using isothermal titration calorimetry

  • Analyze conformational changes using circular dichroism spectroscopy

Data Analysis Framework:

  • Create a comprehensive mutation-activity relationship table

  • Develop 3D structural models incorporating mutation data

  • Correlate changes in activity with specific structural elements

This approach has successfully identified critical functional residues in other plant HMGRs and can be adapted specifically for rice HMG1.

How does rice HMG1 expression respond to different abiotic stress conditions, and what regulatory elements control these responses?

Rice HMG1 expression exhibits dynamic responses to abiotic stresses, influenced by specific regulatory elements in its promoter region. Based on analysis of promoter regions in other rice genes, the following methodological approach can determine HMG1 stress responses:

Experimental Design for Stress Response Analysis:

  • Generate transgenic rice lines with HMG1 promoter:reporter constructs

  • Apply controlled stress treatments:

    • Drought (PEG or soil water deficit)

    • Salt (NaCl gradients)

    • Temperature (heat/cold shock)

    • Reactive oxygen species (H₂O₂ treatment)

  • Measure reporter activity across tissues and time points

  • Correlate with endogenous HMG1 transcript levels via qRT-PCR

  • Validate protein levels via western blotting

Promoter Analysis Methodology:
Based on patterns observed in other rice genes like AHL family members, HMG1 likely contains specific stress-responsive elements. Analysis should focus on:

  • Low-temperature responsive elements (LTR)

  • MYB binding sites (MBS) for drought response

  • Abscisic acid responsive elements (ABRE)

  • Reactive oxygen species responsive elements

Transgenic Complementation Studies:

  • Generate HMG1 overexpression lines

  • Create HMG1 knockdown/knockout lines

  • Test stress tolerance phenotypes

  • Measure metabolite profiles under stress conditions

Drawing parallels from studies of other rice genes, specific promoter elements can be linked to stress responses. For example, in AHL genes, 17 of 20 genes contained LTR elements associated with low-temperature response, and OsAHL7 contained 10 ABRE elements associated with ABA response .

What are the most effective experimental approaches for studying rice HMG1 protein-DNA interactions?

Although HMG1 is primarily an enzyme in the mevalonate pathway, some evidence suggests potential DNA interaction capabilities. Drawing from methodologies used to study rice HMGB1 protein-DNA interactions, the following approaches could be adapted:

Electrophoretic Mobility Shift Assay (EMSA):

  • Principle: Detect protein-DNA complex formation through migration retardation

  • Protocol:

    • Incubate purified recombinant HMG1 with labeled DNA probes

    • Analyze complex formation by native gel electrophoresis

    • Include competition assays with unlabeled DNA

    • Test different DNA structures (linear, curved, four-way junctions)

Rice HMGB1 has demonstrated binding to four-way junction DNA and DNA minicircles, providing a methodological framework that could be adapted for HMG1 studies .

DNA Bending Analysis:

  • T4 ligase-mediated circularization assays with short DNA fragments

  • Circular dichroism analysis to detect conformational changes in DNA upon protein binding

  • Atomic force microscopy to visualize protein-induced DNA bending

Chromatin Immunoprecipitation (ChIP):

  • Use anti-HMG1 antibodies to immunoprecipitate protein-DNA complexes

  • Sequence captured DNA to identify genomic binding sites

  • Validate binding sites using reporter gene assays

These methodologies have successfully characterized DNA-binding properties of rice HMGB1, showing it can increase DNA flexibility with the basic N-terminal domain enhancing DNA binding affinity .

How can systems biology approaches be used to understand the role of rice HMG1 in metabolic networks?

Integrating rice HMG1 into systems-level analyses requires multidisciplinary approaches:

Multi-omics Integration Methodology:

  • Transcriptomics:

    • RNA-seq of HMG1 overexpression/knockdown lines

    • Identification of co-expressed gene networks

    • Temporal expression analysis during development and stress

  • Proteomics:

    • Identification of HMG1 protein interaction partners

    • Phosphoproteomics to detect regulatory modifications

    • Protein complex purification and characterization

  • Metabolomics:

    • Targeted analysis of isoprenoid pathway metabolites

    • Untargeted metabolomics to identify broader metabolic impacts

    • Flux analysis using stable isotope labeling

Network Analysis Framework:

  • Generate protein-protein interaction networks

  • Develop metabolic flux models incorporating HMG1

  • Identify regulatory hubs that control HMG1 activity

  • Map cross-talk between isoprenoid synthesis and other pathways

Validation Through Genetic Manipulation:

  • CRISPR/Cas9 gene editing to create precise mutations

  • RNAi knockdown for tissue-specific expression modulation

  • Overexpression studies with native and modified promoters

This systems biology framework provides a comprehensive understanding of HMG1's role within rice metabolism, revealing regulatory mechanisms and potential biotechnological targets.

What are the methodological considerations for studying rice HMG1 in relation to plant immunity and stress signaling?

Understanding the role of rice HMG1 in immunity and stress signaling requires specialized experimental approaches:

Pathogen Challenge Methodology:

  • Inoculate HMG1 transgenic lines with rice pathogens (bacterial, fungal)

  • Measure disease progression, pathogen proliferation

  • Analyze defense-related metabolite production (phytoalexins)

  • Monitor reactive oxygen species generation and scavenging

Hormone Crosstalk Analysis:

  • Exogenous application of defense hormones (salicylic acid, jasmonic acid)

  • Monitor HMG1 expression/activity changes

  • Analyze isoprenoid-derived defense compound production

  • Study HMG1 promoter response to hormone treatments

Signal Transduction Pathway Mapping:

  • Pharmacological inhibition of specific signaling components

  • Genetic interaction studies with known defense regulators

  • Calcium signaling analysis following elicitor treatment

  • MAPK activation patterns in HMG1-modified plants

Drawing parallels from studies of rice TCS (Two-Component System) proteins that participate in several important physiological phenomena including stress responses , and HMGB1's role in signaling tissue damage , these methodologies can uncover previously unknown roles of HMG1 in rice immunity.

What computational approaches are most effective for predicting substrates and inhibitors of rice HMG1?

The following computational methodologies provide robust frameworks for studying rice HMG1 interactions:

Structure-Based Virtual Screening:

  • Homology model development:

    • Generate rice HMG1 3D structure using characterized HMGRs as templates

    • Refine model through energy minimization and molecular dynamics

    • Validate model using Ramachandran plots and quality assessment tools

  • Molecular docking:

    • Define binding site based on conserved catalytic residues

    • Screen compound libraries against the binding site

    • Rank compounds based on binding energy and interaction patterns

  • Molecular dynamics simulations:

    • Analyze protein-ligand complex stability over nanosecond timescales

    • Identify key interaction residues and binding conformations

    • Calculate binding free energy using MM/PBSA or FEP methods

Machine Learning Approaches:

  • Develop QSAR models based on known HMGR inhibitors

  • Implement random forest or neural network classifiers for activity prediction

  • Utilize pharmacophore modeling to identify essential interaction features

  • Apply scaffold hopping to discover novel inhibitor chemotypes

Validation Protocol:

  • Select top-ranked compounds from computational analysis

  • Test binding affinity using biophysical methods (ITC, SPR)

  • Measure enzyme inhibition in vitro

  • Evaluate cellular activity in plant systems

This computational framework provides a rational approach to discovering novel modulators of rice HMG1 activity for both fundamental research and potential agricultural applications.

How can rice HMG1 be engineered to enhance metabolic flux toward valuable isoprenoid compounds?

Engineering rice HMG1 for improved metabolic flux requires systematic protein engineering approaches:

Enzyme Engineering Strategies:

  • Rational design:

    • Identify rate-limiting steps through kinetic analysis

    • Modify regulatory domains to reduce feedback inhibition

    • Enhance catalytic efficiency through active site modifications

    • Improve NADPH binding through cofactor specificity engineering

  • Directed evolution:

    • Develop high-throughput screening for improved variants

    • Apply error-prone PCR for random mutagenesis

    • Use DNA shuffling to combine beneficial mutations

    • Implement CRISPR-based in vivo directed evolution

Metabolic Engineering Framework:

  • Modify subcellular localization to optimize substrate access

  • Co-express rate-limiting enzymes to prevent bottlenecks

  • Balance expression levels across pathway components

  • Implement dynamic regulatory systems for optimal flux control

Evaluation Methodology:

  • Measure target isoprenoid compound levels via GC-MS or LC-MS

  • Monitor metabolic intermediates to identify remaining bottlenecks

  • Assess plant phenotype and fitness under field conditions

  • Evaluate stress tolerance of engineered plants

This engineering framework provides a systematic approach to harnessing rice HMG1 for enhanced production of valuable isoprenoids such as antimicrobial phytoalexins or nutritionally important compounds.

What methodological approaches can resolve contradictory data regarding rice HMG1 function across different experimental systems?

Resolving contradictory findings requires rigorous methodological standardization and careful experimental design:

Standardization Protocol:

  • Develop unified experimental conditions:

    • Standardize growth conditions (light, temperature, media)

    • Establish common developmental stages for analysis

    • Create uniform stress application protocols

    • Standardize enzyme preparation and assay conditions

  • Cross-laboratory validation:

    • Exchange genetic materials between research groups

    • Perform identical experiments in multiple laboratories

    • Develop standard operating procedures (SOPs)

    • Establish positive and negative controls for key assays

Contradictory Data Resolution Framework:

  • Perform meta-analysis of published results

  • Identify variables that might explain discrepancies

  • Design experiments specifically targeting areas of disagreement

  • Develop mathematical models to reconcile apparently conflicting results

Methodology for Addressing Specific Contradictions:

  • Generate isogenic lines with controlled genetic backgrounds

  • Perform side-by-side comparisons of different rice subspecies

  • Utilize both in vitro biochemical approaches and in planta studies

  • Apply systems biology approaches to contextualize isolated findings

This methodological framework provides a structured approach to resolving contradictory data, ultimately leading to a more coherent understanding of rice HMG1 function across diverse experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.