Recombinant Oryza sativa subsp. indica Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; 9311073; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPG KKYSEIVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVR KILRKEKGGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in rice plants?

Apocytochrome f is a protein encoded by the petA gene located in the chloroplast genome of rice (Oryza sativa). It functions as a crucial component of the cytochrome b6f complex in the photosynthetic electron transport chain. The protein participates in electron transfer between photosystem II and photosystem I, making it essential for photosynthesis and energy production in rice plants . The mature protein contains a heme group after post-translational modification, and the "apo" form refers to the protein prior to this addition. In Oryza sativa subsp. indica, the protein has specific sequence characteristics that distinguish it from other rice varieties.

What are the most effective expression systems for producing Recombinant Oryza sativa subsp. indica Apocytochrome f?

Rice-based expression systems have emerged as particularly effective platforms for producing Recombinant Oryza sativa subsp. indica Apocytochrome f. The methodological approach involves several critical steps:

  • Vector design optimization: Utilizing plant-specific expression vectors with appropriate promoters (frequently the 35S promoter) and chloroplast-targeting sequences.

  • Transformation methods: For rice-based expression, both Agrobacterium-mediated transformation and biolistic delivery have proven effective, with transformation efficiency rates varying between 5-15% depending on the specific protocol .

  • Selection system: Employing antibiotic resistance markers followed by PCR validation to confirm successful transformants.

  • Expression conditions: Optimizing growth conditions (temperature, light cycles, and nutrient availability) to maximize protein accumulation.

Rice suspension cell cultures provide advantages over whole plants for certain applications, offering shorter production cycles (15-20 days) compared to transgenic plants (>90 days) . Several studies indicate that rice-based systems can produce functional recombinant proteins with proper folding and post-translational modifications, making them suitable for producing chloroplast proteins like Apocytochrome f .

What purification strategies yield the highest purity and functional activity for Recombinant Apocytochrome f?

Purification of Recombinant Apocytochrome f requires specialized protocols to preserve structure and function. A multi-step purification strategy is recommended:

  • Initial extraction: Homogenization in Tris-based buffer (pH 7.5-8.0) containing glycerol (50%) for stabilization and protease inhibitors is essential, typically conducted at 4°C to prevent protein degradation .

  • Chromatographic separation: Sequential purification using:

    • Ion exchange chromatography (DEAE or Q-Sepharose)

    • Hydrophobic interaction chromatography

    • Size exclusion chromatography for final polishing

  • Quality assessment: Evaluating protein purity via SDS-PAGE (>95% purity is desirable) and confirming functionality through electron transport activity assays.

For researchers requiring high-throughput analysis, inclusion of affinity tags during recombinant production can facilitate purification, though tags must be positioned to avoid interference with functional domains. Purified protein can be stored in Tris-based buffer with 50% glycerol, but repeated freeze-thaw cycles should be avoided to maintain functional integrity .

How can Recombinant Apocytochrome f be used to study electron transport mechanisms in rice under stress conditions?

Recombinant Apocytochrome f serves as a powerful tool for investigating electron transport mechanisms under various stress conditions. Methodological approaches include:

  • In vitro reconstitution studies: Purified Recombinant Apocytochrome f can be used in reconstituted systems to measure electron transfer rates under controlled conditions mimicking various stresses (salinity, drought, temperature extremes).

  • Mutation analysis: Site-directed mutagenesis of key residues can identify critical amino acids involved in stress response, particularly those affecting interaction with plastocyanin or stability under oxidative conditions.

  • Comparative stress physiology: Studies comparing electron transport efficiency between wild-type and stress-resistant rice varieties can elucidate adaptive mechanisms .

Recent investigations have shown that iron toxicity stress significantly affects electron transport components in rice, with increased accumulation of reactive oxygen species (ROS) observed in stressed plants . Under such conditions, the oxidation-reduction state of cytochrome f changes measurably, providing insights into stress adaptation mechanisms.

Research findings indicate that ROS accumulation following pathogen infection may interact with the cytochrome b6f complex, with H₂O₂ and O₂⁻ accumulation observed in leaves surrounding lesions after Rhizoctonia solani AG1-IA infection . This suggests potential interactions between biotic stress responses and electron transport components like Apocytochrome f.

What role does Apocytochrome f play in chloroplast-nuclear communication during abiotic stress responses?

Apocytochrome f is increasingly recognized as a potential mediator in retrograde signaling from chloroplast to nucleus during stress responses. Advanced research methodology in this area typically involves:

  • Transcriptomic analysis: RNA-seq experiments comparing wild-type plants to those with altered Apocytochrome f expression reveal downstream nuclear gene regulation patterns. For instance, comparative transcriptomic analysis of plants with altered expression of chloroplast proteins has shown significant changes in nuclear gene expression profiles, suggesting retrograde signaling pathways .

  • Metabolite profiling: Changes in redox-active metabolites downstream of altered electron transport can be quantified using LC-MS/MS.

  • Protein-protein interaction studies: Yeast two-hybrid or co-immunoprecipitation methods to identify interacting partners of Apocytochrome f that may function in signaling cascades.

Recent studies show that alteration of cytochrome P450 proteins in rice affects expression of jasmonic acid (JA)-dependent defense responses and reactive oxygen species (ROS) accumulation . While not directly investigating Apocytochrome f, these findings suggest the importance of redox components in chloroplast-nuclear communication during stress responses.

How can genetic diversity in the petA gene be leveraged for crop improvement?

Genetic diversity in the petA gene across rice varieties represents a valuable resource for crop improvement. Methodological approaches to leverage this diversity include:

  • Molecular marker development: SNP and InDel markers within and flanking the petA gene region can be developed for marker-assisted selection. Research on rice organelle genomes has identified numerous genetic variations, including SNPs, InDels, and even novel Reverse Complementary Variations (RCVs) in chloroplast genes that could be exploited .

  • CRISPR-Cas9 targeted editing: Precise modification of petA sequences based on naturally occurring beneficial variants can enhance photosynthetic efficiency.

  • Haplotype analysis: Comprehensive evaluation of petA haplotypes across diverse germplasm can identify superior variants for breeding programs.

Research on Hassawi rice (a landrace adapted to harsh conditions) revealed significant variation in chloroplast genes compared to other varieties, suggesting adaptive evolution of organelle genomes in response to environmental pressures . Analysis of rice varieties adapted to different environmental conditions shows:

Rice VarietyNotable petA FeaturesAdaptive Significance
Hassawi-1Contains unique RCVs in cp genomeAdaptation to drought and salinity
TeqingHigher expression of defense genesModerate resistance to pathogens
IR6Responsive to UV-B stressAdaptation to high light intensity

These findings suggest that petA genetic diversity could be leveraged to develop rice varieties with enhanced photosynthetic efficiency under stress conditions .

What methodologies are most effective for analyzing petA gene expression variation across developmental stages and tissues?

Analysis of petA gene expression across developmental stages and tissues requires sophisticated methodological approaches:

  • Tissue-specific RNA isolation: Optimized protocols for isolating intact RNA from different rice tissues (especially chloroplast-rich tissues) are essential, typically involving modified TRIzol extraction with additional purification steps to remove polysaccharides and secondary metabolites .

  • Quantitative expression analysis: RT-qPCR using petA-specific primers, normalized against stable chloroplast reference genes (such as 16S rRNA), provides accurate quantification of expression levels.

  • In situ hybridization: For spatial expression patterns within tissues, using DIG-labeled RNA probes complementary to petA transcripts.

  • Developmental transcriptomics: RNA-seq analysis across key developmental timepoints (germination, vegetative growth, reproductive transition, seed filling) can reveal temporal expression patterns.

Research on rice proteomics has demonstrated significant variations in chloroplast protein accumulation across developmental stages, suggesting that petA expression may similarly show developmental regulation . Comparative proteomic studies between different rice varieties (such as Japonica REX and Indica IR6) have revealed variety-specific protein accumulation patterns under stress conditions .

What structural features of Apocytochrome f are critical for its interaction with plastocyanin?

The structural interaction between Apocytochrome f and plastocyanin is crucial for efficient electron transfer. Methodological approaches to studying these interactions include:

  • Homology modeling: Using the known crystal structures of cytochrome f from other species to predict the structure of Oryza sativa Apocytochrome f, with particular focus on the plastocyanin binding site.

  • Molecular dynamics simulations: Simulating the interaction between Apocytochrome f and plastocyanin under various conditions to identify key interaction residues and conformational changes.

  • Mutagenesis studies: Site-directed mutagenesis of predicted interface residues followed by binding assays to validate in silico predictions.

Critical structural features include:

  • The lysine-rich region (residues 65-71: LANGKKG) that forms salt bridges with acidic residues on plastocyanin

  • The hydrophobic patch surrounding the exposed heme edge that facilitates electron transfer

  • The flexible loop regions that accommodate plastocyanin docking

Research on recombinant proteins from rice has demonstrated the importance of maintaining proper protein folding and conformation for functional activity , suggesting that structural integrity of Apocytochrome f is essential for efficient interaction with electron transfer partners.

How can molecular dynamics simulations be optimized to study the effects of environmental stressors on Apocytochrome f structure and function?

Molecular dynamics (MD) simulations provide valuable insights into Apocytochrome f structure-function relationships under stress conditions. Methodological considerations include:

  • Force field selection: CHARMM36 or AMBER force fields with specialized parameters for heme groups and metal coordination are recommended for accurate simulation of Apocytochrome f.

  • Environmental modeling: Simulating conditions that mimic specific stressors:

    • Elevated temperature (303-313K)

    • Altered pH (simulated through protonation state adjustments)

    • Increased ionic strength (additional Na⁺/Cl⁻ ions)

    • Oxidative stress (modified redox parameters for coordinated metal)

  • Analysis parameters: Key metrics to evaluate include:

    • RMSD of backbone atoms over time

    • Hydrogen bond network stability

    • Solvent accessible surface area of key functional regions

    • Distance measurements between electron transfer partners

  • Simulation time scale: Minimum of 100-200ns is recommended to capture relevant conformational changes, with extended simulations (>500ns) for studying more subtle effects.

The plasticity of protein structure under different environments has been demonstrated in research on recombinant proteins from rice , suggesting that MD simulations could provide valuable insights into how environmental stressors affect Apocytochrome f function.

How does the structure and function of Apocytochrome f differ between Oryza sativa subsp. indica and other Oryza species?

Comparative analysis of Apocytochrome f across Oryza species reveals evolutionary patterns and functional adaptations. Methodological approaches include:

  • Phylogenetic analysis: Construction of maximum likelihood trees based on petA sequences from diverse Oryza species to trace evolutionary relationships.

  • Selective pressure analysis: Calculation of Ka/Ks ratios to identify regions under positive, neutral, or purifying selection.

  • Structural comparison: Homology modeling of Apocytochrome f from different species followed by structural superimposition to identify conserved and variable regions.

Research on the organelle genomes of Hassawi rice has shown differences in chloroplast gene content and organization compared to other rice varieties . Comparative analysis revealed that while functional genes are generally conserved, there are significant variations in non-coding regions and some sequence polymorphisms within coding regions that may affect protein structure and function.

The analysis of Reverse Complementary Variations (RCVs) in chloroplast genomes has shown differences between rice subspecies, with specific variations that can be used as genetic markers to distinguish between indica and japonica types . These genomic differences may translate to subtle functional differences in chloroplast proteins like Apocytochrome f.

What methodological approaches are most effective for analyzing the co-evolution of petA with other components of the photosynthetic electron transport chain?

Co-evolutionary analysis of petA with other photosynthetic components requires sophisticated methodological approaches:

  • Correlated mutation analysis: Identifying co-evolving residues between Apocytochrome f and its interaction partners (particularly plastocyanin and cytochrome b6) using algorithms such as PSICOV or DCA (Direct Coupling Analysis).

  • Genome-wide association studies: Correlating natural variations in petA with variations in other photosynthetic genes across diverse rice accessions.

  • Ancestral sequence reconstruction: Inferring ancestral sequences of petA and its interacting partners to track co-evolutionary trajectories.

  • Interspecific hybridization experiments: Creating cybrid lines with organelles from one species and nuclear genome from another to study compatibility of co-evolved components.

Research on rice chloroplast genomes has shown that while gene content is generally conserved, there are significant variations in genome structure and gene order that may reflect co-evolutionary processes . The identification of species-specific insertions/deletions (InDels) in chloroplast genomes suggests potential co-evolutionary adaptations in the photosynthetic apparatus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.