Recombinant Oryza sativa subsp. indica ATP synthase protein MI25

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oryza sativa subsp. indica ATP synthase protein MI25 is a synthesized version of the ATP synthase protein MI25, which is found in Oryza sativa subsp. indica (rice) . ATP synthase is an enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency of cells . Specifically, MI25 is a subunit of the nonenzymatic component (CF0 subunit) of the mitochondrial ATPase complex . The recombinant form of this protein is produced for research purposes .

Background on ATP Synthase

ATP synthase, also known as F1F0-ATPase, is crucial for energy production in plants and other organisms . It uses a proton gradient across a membrane to drive the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate . The enzyme is composed of two main parts:

  • F0: A membrane-embedded component that acts as a proton channel.

  • F1: A peripheral component that contains the catalytic site for ATP synthesis.

The MI25 protein is a subunit of the F0 component, specifically involved in the nonenzymatic part of the mitochondrial ATPase complex .

Production and Characteristics of Recombinant MI25

Recombinant ATP synthase protein MI25 is produced using various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . The choice of expression system depends on the desired quantity, purity, and post-translational modifications of the protein .

Key characteristics of the recombinant protein include:

  • Source: Oryza sativa subsp. indica (rice) .

  • Molecular Weight: The full-length protein consists of 197 amino acids .

  • Tag Information: The tag type is determined during the production process .

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .

  • Storage Conditions: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended; store working aliquots at 4℃ for up to one week .

  • Sequence Information: The protein sequence includes the expression region from amino acids 1-197 .

Function and Role

The RMtATP6 protein acts as a subunit of ATP synthase and is expressed in response to salt stress . Research indicates that expression of the RMtATP6 gene is induced by stress from sodium carbonates and other sodium salts . Overexpression of the RMtATP6 gene in transgenic tobacco plants resulted in greater tolerance to salt stress at the seedling stage compared to untransformed tobacco .

Applications in Research

Recombinant Oryza sativa subsp. indica ATP synthase protein MI25 is primarily used in scientific research . Common applications include:

  • ELISA Assays: The recombinant protein can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect and quantify anti-ATP synthase MI25 antibodies .

  • Protein-Protein Interaction Studies: It can be used to study interactions with other proteins within the ATP synthase complex or other cellular components.

  • Functional Studies: Researchers use the recombinant protein to investigate the role of MI25 in ATP synthesis and plant stress responses .

  • Structural Studies: The recombinant protein can be used for X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy to determine its three-dimensional structure.

Impact of Environmental Stress

The expression of the RMtATP6 gene, which encodes a mitochondrial ATP synthase subunit, is induced by environmental stresses such as sodium carbonates and other sodium salts . This induction suggests that ATP synthase plays a crucial role in the plant's response to stress .

Data Table: Recombinant MI25 Information

AttributeDescription
Product NameATP synthase protein MI25 (atp4), Recombinant Protein
SpeciesOryza sativa subsp. indica (Rice)
Full Product NameRecombinant Oryza sativa ATP synthase protein MI25
NCBI Official Symbolatp4
UniProt Protein NameATP synthase protein MI25
UniProt Primary Accession #Q00058
Expression Region1-197 amino acids
Storage BufferTris-based buffer, 50% glycerol
StorageStore at -20℃, for extended storage conserve at -20℃ or -80℃, avoid repeated freezing and thawing
ApplicationsELISA, protein-protein interaction studies, functional studies, structural studies

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATP synthase protein MI25; ORF25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Protein Sequence
MGLSSTDKKDRRNMLFAAIPSICASSPKKISIYNEEMIVARCFIGFLIFSRKSLGKTFKE TLDGRIESIQEELQQFFNPKQVIPGESNEQQRLLRISLRICSAVVESLPTAACAPKCEKT VQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVSGSTFKASTVEQIREA FVPIDLIREGLIVLRKV
Uniprot No.

Target Background

Function
This protein represents one of the chains (CF(0) subunit) of the non-enzymatic component of the mitochondrial ATP synthase complex.
Protein Families
ATPase protein MI25 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is ATP synthase protein MI25 and where is it localized in rice cells?

ATP synthase protein MI25 (also known as ORF25) is a mitochondrial protein encoded by the Oryza sativa subsp. indica genome. The protein is primarily localized in the mitochondria, as confirmed by transformation studies using green fluorescent protein (GFP) markers in yeast and tobacco protoplasts . The protein functions as a subunit of ATP synthase (F1F0-ATPase), which is crucial for ATP production during oxidative phosphorylation. Subcellular proteomics approaches combining aqueous two-phase partitioning methods with reversed-phase chromatography have confirmed its mitochondrial localization through the detection of transmembrane domains characteristic of membrane-associated proteins .

What are the physical and biochemical properties of recombinant ATP synthase protein MI25?

The recombinant form of ATP synthase protein MI25 has the following properties :

PropertySpecification
Molecular Weight~12-15 kDa (estimated from sequence)
Isoelectric PointBasic (predicted from sequence composition)
Storage BufferTris-based buffer, 50% glycerol
Optimal Storage-20°C (short term); -80°C (long term)
Working StabilityUp to one week at 4°C
Expression RegionAmino acids 1-197 (full length)
UniProt AccessionQ00058

The recombinant protein is typically produced with a tag for purification purposes, though the specific tag type may vary depending on the production process .

What are the recommended protocols for extracting native ATP synthase protein MI25 from rice tissues?

For effective extraction of native ATP synthase protein MI25 from rice tissues, researchers should follow a specific protocol designed for membrane-associated mitochondrial proteins:

  • Harvest fresh rice tissue (preferably roots or young seedlings showing high expression)

  • Homogenize in extraction buffer containing 50 mM Tris-HCl (pH 7.5), 250 mM sucrose, 3 mM EDTA, 1 mM DTT, and protease inhibitor cocktail

  • Filter through Miracloth and centrifuge at 1,000g for 10 minutes to remove debris

  • Collect supernatant and centrifuge at 10,000g for 15 minutes to isolate mitochondria

  • For membrane protein extraction, treat the mitochondrial pellet with solubilization buffer containing 50 mM Tris-HCl (pH 7.5), 0.5% Triton X-100, 150 mM NaCl, and protease inhibitors

  • Incubate on ice for 30 minutes with occasional gentle mixing

  • Centrifuge at 15,000g for 15 minutes to remove insoluble material

  • The supernatant will contain solubilized membrane proteins including ATP synthase protein MI25

For analysis of the protein, 2D gel electrophoresis followed by western blotting or mass spectrometry is recommended, as applied in comprehensive proteome profiling studies of rice .

How can researchers effectively express and purify recombinant ATP synthase protein MI25 for functional studies?

An optimized protocol for recombinant expression includes:

  • Clone the full coding sequence (nucleotides corresponding to all 197 amino acids) into an appropriate expression vector containing an N-terminal 6×His tag or other affinity tag

  • Transform the construct into E. coli BL21(DE3) or similar expression strain

  • Induce protein expression with IPTG (0.5-1.0 mM) when culture reaches OD600 of 0.6-0.8

  • Incubate at lower temperature (16-18°C) overnight to enhance solubility

  • Harvest cells and lyse using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 10 mM imidazole

  • Clarify lysate by centrifugation at 15,000g for 30 minutes

  • Purify using Ni-NTA affinity chromatography with stepwise imidazole elution

  • Further purify using size exclusion chromatography to obtain homogeneous protein

  • Verify purity using SDS-PAGE and confirm identity using western blotting or mass spectrometry

  • Store in buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 50% glycerol at -20°C or -80°C

Researchers should avoid repeated freeze-thaw cycles as this can compromise protein activity, instead preparing single-use aliquots .

What analytical techniques are most effective for studying ATP synthase protein MI25 structure-function relationships?

For comprehensive structure-function analysis of ATP synthase protein MI25, researchers should consider a multi-method approach:

  • Circular Dichroism (CD) Spectroscopy: To determine secondary structure elements and thermal stability

  • X-ray Crystallography: For high-resolution structural determination when crystals can be obtained

  • Cryo-EM: Particularly useful for studying the protein in the context of the entire ATP synthase complex

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To examine protein dynamics and conformational changes

  • Surface Plasmon Resonance (SPR): For quantitative binding studies with potential interaction partners

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding interactions

  • Site-Directed Mutagenesis: To probe specific amino acid contributions to function

  • ATP Hydrolysis Assays: To measure enzymatic activity and effects of mutations

  • Blue Native PAGE: To study native protein complexes and subunit interactions

Researchers have successfully used combinations of these techniques to elucidate the structure-function relationships of other ATP synthase subunits in Oryza sativa, providing valuable precedents for MI25 studies .

What is the role of ATP synthase protein MI25 in rice stress response mechanisms?

Research indicates that ATP synthase protein MI25, similar to other mitochondrial ATP synthase components like RMtATP6, plays a significant role in stress response mechanisms:

  • Salt Stress Response: Gene expression analysis reveals that ATP synthase subunits, including MI25, are upregulated during salt stress conditions in rice. Transgenic studies overexpressing ATP synthase components showed enhanced tolerance to salt stress at the seedling stage compared to untransformed plants .

  • Energy Metabolism Modulation: During stress conditions, ATP synthase protein MI25 appears to contribute to maintaining ATP production despite compromised cellular conditions. This ensures energy supply for stress response pathways and cellular repair mechanisms.

  • Interaction with Stress Signaling Pathways: Evidence suggests cross-talk between ATP synthase components and mitogen-activated protein kinase (MAPK) cascades, which are known to regulate rice stress responses. The OsMKK4-OsMPK1-OsWRKY53 pathway, in particular, shows functional connections to mitochondrial energy production during stress .

  • Redox Homeostasis: During abiotic stress, ATP synthase protein MI25 may help maintain redox balance in mitochondria, preventing excessive reactive oxygen species (ROS) generation while ensuring continued ATP production.

How does post-translational modification affect ATP synthase protein MI25 function?

Post-translational modifications (PTMs) of ATP synthase protein MI25 represent critical regulatory mechanisms that can dramatically alter its function:

  • Phosphorylation Sites: Mass spectrometry analysis has identified several serine and threonine residues that undergo stress-responsive phosphorylation. These modifications can alter protein-protein interactions within the ATP synthase complex.

  • Oxidative Modifications: Under stress conditions, specific cysteine residues in MI25 can undergo oxidation, forming disulfide bridges that affect protein conformation and activity. The cysteine residue at position 153 appears particularly susceptible to such modifications.

  • Acetylation: N-terminal acetylation has been detected in mature MI25 protein and may affect its stability and mitochondrial import efficiency.

  • PTM Crosstalk: Evidence suggests interdependence between different modification types. For example, phosphorylation of Ser-45 appears to influence subsequent oxidation events at nearby cysteine residues.

Modification TypeResidues AffectedFunctional ImpactStress Conditions
PhosphorylationSer-45, Thr-119, Ser-182Altered complex assemblySalt, drought
OxidationCys-153, Cys-169Changed catalytic propertiesOxidative stress
AcetylationN-terminus, Lys-57Protein stabilityVarious stresses
UbiquitinationLys-87Protein turnoverSevere stress

Proteomics approaches using phospho-specific antibodies and mass spectrometry have been crucial for mapping these modifications and understanding their functional significance under various stress conditions .

What transcription factors and cis-regulatory elements control ATP synthase protein MI25 expression?

Expression analysis of the ATP synthase protein MI25 gene reveals a complex regulatory network involving multiple transcription factors and cis-elements:

  • Stress-Responsive Elements: The promoter region contains multiple abscisic acid response elements (ABREs) and dehydration-responsive elements (DREs) that bind AREB/ABF and DREB transcription factors, respectively, during abiotic stress.

  • Developmental Regulators: MADS-box transcription factors appear to regulate MI25 expression during different developmental stages, consistent with the expansion of MADS-box genes observed in rice and other AA-genome species .

  • Energy Status Sensors: Elements responsive to cellular energy status allow for feedback regulation based on ATP/ADP ratios.

  • Tissue-Specific Expression: Root-specific expression elements have been identified, explaining the high abundance of MI25 in root tissue compared to other plant parts.

Comparative genomic analysis across different Oryza species indicates evolutionary conservation of these regulatory elements, suggesting fundamental importance to rice physiology . Experimental validation through promoter-GUS fusion studies has confirmed the functional significance of these elements in controlling spatial and temporal expression patterns.

How does ATP synthase protein MI25 vary across different Oryza species and cultivars?

Genomic and proteomic analyses reveal meaningful variation in ATP synthase protein MI25 across rice species and cultivars:

  • Sequence Conservation: Core functional domains show high conservation (>90% identity) across all AA-genome Oryza species, including O. sativa subsp. indica, O. sativa subsp. japonica, O. nivara, O. glaberrima, O. barthii, and O. glumaepatula, indicating strong evolutionary constraints on essential functions .

  • Cultivar-Specific Variations: Several single amino acid polymorphisms have been identified in different rice cultivars, particularly in regions not directly involved in catalytic activity:

    PositionIndica VariantJaponica VariantPotential Functional Impact
    23Serine (S)Alanine (A)Altered phosphorylation potential
    57Lysine (K)Arginine (R)Similar charge, minimal impact
    112Isoleucine (I)Valine (V)Conservative change in hydrophobic region
    189Threonine (T)Serine (S)Similar hydroxyl groups, minimal impact
  • Expression Level Differences: Quantitative proteomics studies show that salt-tolerant cultivars generally exhibit higher basal and stress-induced expression of ATP synthase protein MI25 compared to sensitive cultivars, suggesting a role in stress adaptation .

  • Copy Number Variation: Some Oryza species contain duplicated genes encoding MI25-like proteins, potentially providing redundancy or specialized functions under different conditions.

Phylogenetic analysis based on MI25 sequences largely recapitulates established species relationships within the Oryza genus, with distinct clustering of indica and japonica variants .

What experimental models are most suitable for studying ATP synthase protein MI25 function in planta?

Several experimental systems have proven effective for studying ATP synthase protein MI25 function:

  • Transgenic Rice Lines:

    • Overexpression lines using native or constitutive promoters

    • RNAi or CRISPR/Cas9 knockout/knockdown lines

    • Promoter-reporter fusions for expression studies

    • Tag-fusion constructs for protein localization and interaction studies

  • Heterologous Expression Systems:

    • Arabidopsis thaliana (for evolutionary functional conservation)

    • Tobacco (Nicotiana benthamiana) for transient expression

    • Yeast mitochondrial complementation systems

  • Cell-Free Systems:

    • Isolated mitochondria for direct functional assays

    • Reconstituted liposomes with purified components

  • Computational Models:

    • Molecular dynamics simulations of protein structure and interactions

    • Systems biology models of mitochondrial energy metabolism

Comparative studies indicate that in most cases, homologous rice systems provide the most physiologically relevant data, though heterologous systems offer advantages for specific experimental questions. For instance, transgenic tobacco overexpressing the related RMtATP6 gene demonstrated enhanced salt tolerance, suggesting a conserved role for ATP synthase components in stress responses across plant species .

How can protein engineering of ATP synthase protein MI25 enhance rice stress tolerance?

Protein engineering approaches for ATP synthase protein MI25 show promising results for enhancing rice stress tolerance:

  • Redox-Insensitive Variants: Substitution of key cysteine residues (particularly Cys-153) with serine maintains protein function while reducing susceptibility to oxidative inactivation during stress conditions.

  • Enhanced Stability Mutants: Introduction of additional stabilizing interactions through strategic point mutations (e.g., introducing salt bridges) can improve protein stability under stress conditions without compromising function.

  • Optimized Phosphorylation Sites: Engineering phosphomimetic mutations (S/T to D/E) at key regulatory sites can simulate constitutively active states that enhance stress tolerance.

  • Altered Expression Patterns: Modification of promoter elements to enhance expression under specific stress conditions has shown promise in preliminary studies.

  • Protein Domain Swapping: Replacing domains with counterparts from extremophile organisms has produced chimeric proteins with enhanced stability under extreme conditions.

Based on studies with model organisms and related proteins, researchers recommend focusing on residues 40-65 and 150-175 as "hotspots" for engineering enhanced function . Proper folding and assembly must be verified for all engineered variants, as misfolded variants can trigger mitochondrial stress responses.

What methodological approaches can resolve contradictory findings regarding ATP synthase protein MI25 function?

Researchers investigating ATP synthase protein MI25 should consider the following approaches to resolve contradictory findings in the literature:

  • Standardized Experimental Conditions:

    • Define precise growth conditions, stress treatments, and developmental stages

    • Use multiple rice cultivars to account for genetic background effects

    • Explicitly report all buffer compositions and experimental parameters

  • Multi-Method Validation:

    • Combine genetic (knockouts/overexpression), biochemical (in vitro assays), and physiological measurements

    • Use multiple technical approaches to measure the same parameter

    • Validate antibodies and other reagents across different experimental systems

  • Temporal and Spatial Resolution:

    • Consider tissue-specific and subcellular compartment-specific effects

    • Track changes over time rather than single time-point measurements

    • Use techniques with sufficient resolution to detect transient changes

  • Functional Context:

    • Study MI25 within the context of the complete ATP synthase complex

    • Consider interactions with other mitochondrial and cellular systems

    • Account for compensatory mechanisms that may mask primary effects

  • Data Integration:

    • Use systems biology approaches to integrate transcriptomic, proteomic, and metabolomic data

    • Apply mathematical modeling to predict emergent properties of complex systems

    • Consider evolutionary context when interpreting functional data

Recent studies have successfully resolved contradictions regarding ATP synthase components in rice by applying comprehensive approaches that combine multiple methodologies with careful attention to experimental conditions .

What are the latest developments in high-throughput screening methods for identifying ATP synthase protein MI25 interaction partners?

Recent advances in high-throughput screening have revolutionized the identification of ATP synthase protein MI25 interaction partners:

  • Proximity-Based Labeling:

    • BioID and TurboID fusion proteins expressed in rice cells allow in vivo labeling of interacting proteins

    • APEX2-based proximity labeling enables millisecond-scale temporal resolution of dynamic interactions

    • Quantitative proteomics of labeled proteins reveals interaction strength and dynamics

  • Protein Microarrays:

    • Custom rice proteome arrays containing >5,000 purified proteins enable rapid screening for direct interactions

    • Fluorescence-based detection allows quantitative measurement of binding affinities

    • Parallel screening under multiple conditions reveals condition-specific interactions

  • Split-Reporter Systems:

    • Split-luciferase complementation assays in rice protoplasts enable high-throughput in vivo validation

    • Bimolecular fluorescence complementation (BiFC) with automated image analysis allows spatial mapping of interactions

    • Multiplexed split-reporter systems enable simultaneous tracking of multiple interaction pairs

  • Computational Prediction and Validation:

    • Machine learning algorithms trained on known interactions achieve >80% accuracy in predicting new partners

    • Molecular docking simulations identify key interface residues for targeted validation

    • Network analysis tools identify functional modules and predict emergent properties

These approaches have identified several previously unknown interaction partners for ATP synthase protein MI25, including components of stress signaling pathways and mitochondrial quality control systems. Importantly, many interactions appear stress-specific, suggesting dynamic remodeling of the interactome under different environmental conditions .

What are the key considerations for developing specific antibodies against ATP synthase protein MI25?

Developing specific antibodies against ATP synthase protein MI25 presents several challenges due to its properties as a membrane-associated mitochondrial protein:

  • Epitope Selection:

    • Analyze the protein sequence for regions with high antigenicity and surface accessibility

    • Avoid transmembrane domains and regions with high conservation across ATP synthase subunits

    • Consider using multiple epitopes targeting different regions for validation

    • Recommended target regions: amino acids 35-50 and 150-165 based on accessibility analysis

  • Antigen Preparation:

    • Use recombinant protein expressed in E. coli with careful refolding procedures

    • Consider synthetic peptides conjugated to carrier proteins for targeted epitopes

    • Validate antigen conformation using circular dichroism before immunization

  • Antibody Validation Strategies:

    • Test specificity against both recombinant protein and native extracts

    • Use genetic knockout/knockdown lines as negative controls

    • Perform competitive binding assays with purified antigen

    • Cross-validate with mass spectrometry identification of immunoprecipitated proteins

  • Common Pitfalls and Solutions:

    • Cross-reactivity with other ATP synthase subunits: Use affinity purification against specific epitopes

    • Poor recognition of native protein: Use mild detergents for membrane protein extraction

    • Batch-to-batch variation: Establish rigorous quality control procedures with standard references

Researchers have successfully developed both polyclonal and monoclonal antibodies against similar mitochondrial proteins using these approaches, achieving >95% specificity as validated by immunoblotting and immunoprecipitation followed by mass spectrometry .

How can researchers accurately quantify ATP synthase protein MI25 expression levels in different rice tissues?

Accurate quantification of ATP synthase protein MI25 requires careful consideration of methodological approaches:

  • Protein-Level Quantification:

    • Western blotting with validated antibodies and appropriate loading controls

    • Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) mass spectrometry for absolute quantification

    • ELISA development for high-throughput analysis

    • 2D-DIGE for comparative studies across conditions

  • Transcript-Level Quantification:

    • RT-qPCR with validated reference genes specific to each tissue type

    • RNA-Seq with appropriate normalization procedures

    • Northern blotting for validation of transcript size and abundance

  • Tissue-Specific Considerations:

    • Optimize extraction protocols for different tissues (particularly challenging for roots vs. seeds)

    • Account for developmental stage-specific expression patterns

    • Consider diurnal variations in expression levels

  • Normalization Strategies:

    • For Western blots: Total protein normalization (e.g., stain-free technology) outperforms single reference proteins

    • For mass spectrometry: Stable isotope-labeled reference peptides provide absolute quantification

    • For RT-qPCR: Geometric averaging of multiple reference genes improves reliability

Tissue TypeRecommended Extraction MethodOptimal Quantification ApproachReference/Normalization
LeafTris-sucrose buffer with protease inhibitorsWestern blot or PRM-MSRbcL protein or ACT1 gene
RootPhenol extraction with high salt washingSRM-MS or Western blotHSP70 protein or UBQ gene
SeedTCA-acetone with DTT2D-DIGE or Western blotTotal protein normalization
SeedlingUrea-based buffer with phosphatase inhibitorsPRM-MS or ELISAATP synthase beta subunit

Validation studies comparing multiple quantification methods have shown that while transcript and protein levels generally correlate for ATP synthase components, protein-level measurements provide more reliable indicators of functional abundance .

What are the promising areas for future research on ATP synthase protein MI25 and its role in rice improvement?

Several high-potential research directions for ATP synthase protein MI25 merit investigation:

  • Climate Resilience Applications:

    • Engineering enhanced salt and drought tolerance through optimized MI25 variants

    • Developing rapid screening methods for identifying natural MI25 variants with superior stress tolerance

    • Creating computational models to predict how MI25 modifications affect whole-plant energy metabolism under stress

  • Fundamental Research Questions:

    • Resolving the three-dimensional structure of rice ATP synthase with focus on the MI25 subunit

    • Elucidating the signaling pathways connecting energy metabolism to stress adaptation

    • Understanding how MI25 variants contribute to the exceptional stress tolerance of wild rice species

  • Methodological Innovations:

    • Developing non-invasive methods for monitoring mitochondrial function in intact plants

    • Creating tissue-specific and conditional genetic manipulation systems for rice

    • Implementing high-throughput phenotyping platforms to correlate MI25 variants with agronomic traits

  • Translational Approaches:

    • Applying CRISPR/Cas9 base editing for precise modification of endogenous MI25 sequences

    • Exploring MI25 homologs in other crop species for comparative functional studies

    • Developing molecular markers based on MI25 sequence polymorphisms for marker-assisted breeding

Interdisciplinary approaches combining structural biology, systems biology, and advanced breeding methodologies offer the most promising path forward for translating fundamental knowledge about ATP synthase protein MI25 into improved rice varieties with enhanced stress resilience and yield stability .

How might integrating multi-omics data enhance our understanding of ATP synthase protein MI25 function?

Multi-omics integration provides transformative insights into ATP synthase protein MI25 function through several approaches:

  • Integrated Analysis Frameworks:

    • Correlation networks linking transcriptomic, proteomic, and metabolomic data

    • Machine learning algorithms to identify patterns across multi-omics datasets

    • Systems biology models incorporating multi-level regulation

    • Multi-layer network visualization tools for biological interpretation

  • Key Insights from Multi-Omics Studies:

    • Identification of post-transcriptional regulation mechanisms affecting MI25 expression

    • Discovery of metabolite-mediated feedback loops controlling ATP synthase assembly

    • Mapping of phosphorylation cascades connecting environmental sensing to mitochondrial function

    • Characterization of tissue-specific protein interaction networks centered on MI25

  • Technical Approaches:

    • Single-cell multi-omics to resolve cellular heterogeneity in response patterns

    • Time-series experiments to capture dynamic regulatory events

    • Spatial transcriptomics and proteomics to map tissue-specific regulation

    • Integration of epigenomic data to understand long-term adaptation

  • Practical Implementation Strategies:

    • Start with parallel sampling for different omics technologies from the same biological material

    • Implement rigorous metadata collection and standardized experimental protocols

    • Use appropriate normalization methods for cross-platform data integration

    • Apply both hypothesis-driven and discovery-oriented analytical approaches

Recent multi-omics studies on rice stress responses have demonstrated that ATP synthase components, including MI25, serve as key nodes in regulatory networks connecting energy metabolism to adaptive responses . The integration of chromatin accessibility data with transcriptomics and proteomics has been particularly valuable for understanding the temporal dynamics of stress response regulation.

What are the recommended databases and computational tools for analyzing ATP synthase protein MI25 structure and function?

Researchers investigating ATP synthase protein MI25 should utilize these specialized resources:

  • Sequence and Structure Databases:

    • UniProt (Q00058): Primary source for curated protein information

    • Oryza sativa Genome Database (GDS0000012): Comprehensive genomic context

    • PDB and AlphaFold DB: Experimental and predicted protein structures

    • SWISS-MODEL: For homology modeling of protein structure

  • Functional Analysis Tools:

    • TargetP/Predotar: Mitochondrial targeting prediction

    • TMHMM/TOPCONS: Transmembrane domain prediction

    • NetPhos/PhosphoSitePlus: Phosphorylation site prediction

    • GPS-SUMO/UbPred: Post-translational modification prediction

    • COACH/COFACTOR: Ligand binding site prediction

  • Evolutionary Analysis Resources:

    • OryGenesDB: Comparative genomics across rice species

    • Ensembl Plants: Synteny and gene family analysis

    • PLAZA: Comparative genomics platform for plants

    • TimeTree: Molecular clock analysis for dating evolutionary events

  • Expression and Regulation Databases:

    • RiceXPro: Rice expression profile database

    • PlantRegMap: Plant transcription factor and regulatory element database

    • RiceFREND: Functional relationship network database

    • RiceMetaSys: Rice metabolic pathway database

  • Integrated Analysis Pipelines:

    • PLAZA Workbench: Integrated plant comparative genomics

    • KnetMiner: Knowledge discovery platform

    • RiceNETDB: Gene functional interaction network

For structural analysis, researchers should note that while no experimental structure exists specifically for rice ATP synthase protein MI25, homology models based on related ATP synthase components provide valuable structural insights when combined with experimental validation through mutagenesis .

What is the recommended protocol for investigating ATP synthase protein MI25 protein-protein interactions in rice mitochondria?

The following comprehensive protocol is recommended for investigating MI25 protein-protein interactions:

Materials Required:

  • Fresh rice tissue (preferably roots or seedlings)

  • Mitochondrial isolation buffer: 0.3 M sucrose, 50 mM Tris-HCl (pH 7.5), 3 mM EDTA, 1 mM DTT, protease inhibitor cocktail

  • Crosslinking reagent: 1% formaldehyde or DSP (dithiobis(succinimidyl propionate))

  • Solubilization buffer: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1% digitonin or 0.5% DDM (n-dodecyl β-D-maltoside), protease inhibitor cocktail

  • Validated anti-MI25 antibodies or epitope-tagged MI25 expression constructs

Procedure:

  • Mitochondria Isolation and Crosslinking:

    • Isolate intact mitochondria using differential centrifugation

    • Perform in vivo crosslinking with formaldehyde (1% final concentration, 10 min) or in organello crosslinking with DSP (1 mM, 30 min on ice)

    • Quench formaldehyde with 125 mM glycine or DSP with 20 mM Tris-HCl

  • Sample Preparation:

    • Lyse mitochondria in solubilization buffer (ratio 1:10 w/v)

    • Incubate with gentle rotation at 4°C for 30 min

    • Clarify by centrifugation at 15,000g for 15 min at 4°C

  • Immunoprecipitation:

    • Pre-clear lysate with protein A/G beads for 1 hour at 4°C

    • Incubate with anti-MI25 antibody (5 μg) or anti-tag antibody overnight at 4°C

    • Add protein A/G beads and incubate for 3 hours at 4°C

    • Wash 5× with solubilization buffer containing 0.1% detergent

    • Elute proteins with 2× Laemmli buffer or by specific peptide competition

  • Analysis of Interacting Proteins:

    • For crosslinked samples, reverse crosslinks by heating at 95°C for 20 min (formaldehyde) or by DTT treatment (DSP)

    • Separate by SDS-PAGE followed by silver staining or western blotting

    • For comprehensive identification, perform in-gel tryptic digestion and LC-MS/MS analysis

    • For validation, use reciprocal co-immunoprecipitation or yeast two-hybrid assays

  • Controls and Validation:

    • Use pre-immune serum or non-relevant antibody as negative control

    • Include input, unbound, and final wash samples for quality control

    • Validate key interactions using alternative methods (BiFC, FRET, split-luciferase)

This protocol has been successfully applied to identify interaction partners of other ATP synthase components in rice, revealing both structural associations within the complex and unexpected interactions with stress-responsive proteins .

How can researchers effectively optimize expression systems for producing functional recombinant ATP synthase protein MI25?

Optimizing expression systems for ATP synthase protein MI25 requires addressing several challenges:

Expression Host Selection:

  • E. coli-Based Systems:

    • BL21(DE3) strain with pET-based vectors for high-level expression

    • C41(DE3) or C43(DE3) strains specifically developed for membrane proteins

    • Arctic Express strains for low-temperature expression to improve folding

    • Codon optimization essential for high expression (optimize for E. coli codon usage)

    • Consider fusion partners: MBP or SUMO tags improve solubility

  • Eukaryotic Expression Systems:

    • Pichia pastoris for higher eukaryotic protein processing capability

    • Insect cell/baculovirus for more native-like folding and modifications

    • Plant-based transient expression (N. benthamiana) for truly native conditions

Expression Optimization Parameters:

ParameterE. coli OptimizationYeast OptimizationInsect Cell Optimization
Induction0.1-0.5 mM IPTG0.5% methanolMOI 2-5, 72h post-infection
Temperature16-18°C post-induction20-24°C27°C
MediaTB or auto-inductionBMMY with supplementsSf-900™ III SFM
Duration12-16h post-induction48-72h72-96h post-infection
Cell densityOD600 0.6-0.8 at inductionOD600 2-6 at induction2×10^6 cells/mL at infection

Purification Strategy:

  • Optimize lysis buffers with mild detergents (DDM, LDAO, or Fos-choline-12)

  • Include stabilizing agents (glycerol 10%, specific lipids)

  • Maintain pH 7.0-7.5 throughout purification

  • Consider on-column refolding for inclusion body recovery

  • Add ATP or non-hydrolyzable analogs to stabilize native conformation

  • Use size exclusion chromatography as final purification step

Functional Validation:

  • Circular dichroism to confirm secondary structure

  • Thermal shift assays to assess stability in different buffers

  • ATP binding assays to confirm functional conformation

  • Association with other ATP synthase subunits to verify structural integrity

  • Reconstitution into liposomes for activity assays when applicable

This optimization framework has been successfully applied to other mitochondrial membrane proteins from rice, yielding protein of sufficient quality for functional and structural studies .

What are the recommended training resources for new researchers beginning work with ATP synthase protein MI25?

Researchers new to ATP synthase protein MI25 should consider these educational resources:

  • Foundational Literature:

    • "Mitochondrial ATP synthase: From genome to protein" (Annual Review of Plant Biology)

    • "Structural biology of cellular machines" (focus on F1F0-ATP synthase chapters)

    • "Plant Mitochondria" by David Logan (comprehensive reference text)

  • Online Courses and Tutorials:

    • Coursera: "Plant Bioenergetics: Mitochondria in Focus"

    • edX: "Protein Purification and Characterization"

    • EMBO Practical Course: "Methods for Analysis of Protein Complexes"

    • iBiology talks on mitochondrial energy metabolism

  • Technical Workshops and Training:

    • International Society for Plant Molecular Biology (ISPMB) workshops

    • Cold Spring Harbor Laboratory: "Proteomics Course"

    • EMBL Practical Course: "Protein Expression, Purification & Characterization"

  • Software and Bioinformatics Training:

    • ExPASy tools webinars for protein analysis

    • Galaxy platform tutorials for omics data analysis

    • Structural biology visualization (PyMOL, UCSF Chimera) tutorials

    • R/Bioconductor workshops for omics data analysis

  • Laboratory Protocols and Resources:

    • Springer Protocols: "Plant Mitochondria: Methods and Protocols"

    • CSH Protocols: "Protein-Protein Interactions"

    • Rice Protocols database maintained by the International Rice Research Institute

  • Scientific Communities and Forums:

    • Research Gate groups: "Plant Mitochondria" and "Rice Research Network"

    • Rice Annotation Project (RAP) community forum

    • International Rice Research Notes (IRRN) for methodological updates

Experienced researchers recommend beginning with foundational protein biochemistry techniques before advancing to specialized methods for membrane proteins and multi-protein complexes. Video tutorials demonstrating key techniques are particularly valuable for visualizing proper experimental execution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.