Recombinant Oryza sativa subsp. indica ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant AtpI is produced using two primary systems:

  • E. coli: Yields full-length protein with high solubility and purity, ideal for structural studies .

  • Yeast: Used for partial-length protein production, offering eukaryotic post-translational modifications .
    Critical steps include affinity chromatography (via His tag) and lyophilization for long-term storage .

Biochemical Assays

  • SDS-PAGE Analysis: Primary application for purity verification and complex assembly studies .

  • Interaction Studies: Yeast two-hybrid assays confirm AtpI’s interaction with the β-subunit (AtpB) of cpATPase, essential for complex assembly .

Functional Insights

  • Role in ATP Synthase Assembly: AtpI cooperates with auxiliary factors (e.g., YL1, BFA1, BFA3) to stabilize the cpATPase complex .

  • Proton Conductivity: Overexpression of ATP synthase subunits (e.g., AtpD) enhances thylakoid proton conductivity and CO₂ assimilation rates in rice .

Subspecies Variation

  • Indica vs. Japonica: Indica cultivars show distinct genetic architecture in stress tolerance . AtpI’s role in Al tolerance remains unexplored but is hypothesized to intersect with cation transport .

  • Evolutionary Conservation: AtpI homologs in Oryza nivara share 98% sequence identity, highlighting functional conservation .

Mutant Phenotypes

  • yl1-1 Mutants: Exhibit 41.7% reduced cpATPase activity and impaired interaction with AtpB, underscoring AtpI’s assembly role .

  • dcl4 Mutants: Defective siRNA regulation indirectly affects ARF genes linked to chloroplast development .

Industrial and Agricultural Relevance

  • Photosynthesis Optimization: Overexpression of ATP synthase subunits (e.g., AtpD) in rice enhances photosynthetic efficiency by 15–20%, suggesting biotechnological potential .

  • Stress Adaptation: AtpI’s proton channel function may mitigate abiotic stress, though direct evidence is pending .

Challenges and Future Directions

  • Structural Resolution: Full-length AtpI’s transmembrane topology remains uncharacterized due to crystallization challenges .

  • Functional Redundancy: Overlapping roles with auxiliary assembly factors (e.g., PAB, BFA3) complicate mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on your location and purchasing method. For specific delivery timeframes, please contact your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
atpI; 9311039; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
atpI
Target Protein Sequence
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this subunit plays a direct role in facilitating the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the chloroplastic ATP synthase subunit a (atpI) in rice?

ATP synthase subunit a, chloroplastic (atpI) is an essential membrane protein component of the F0 sector of ATP synthase in rice chloroplasts. This protein facilitates proton translocation across the thylakoid membrane, which is fundamental to the chemiosmotic mechanism of ATP production during photosynthesis. In Oryza sativa subsp. indica, atpI is encoded by the chloroplast genome and functions as part of the proton channel within the ATP synthase complex. The protein is also known by alternative names including ATP synthase F0 sector subunit a and F-ATPase subunit IV . The atpI protein contains multiple transmembrane domains that span the thylakoid membrane, forming a crucial part of the pathway for proton movement that powers the rotary mechanism of ATP synthesis. Understanding atpI structure and function provides insights into the fundamental processes of energy conversion in photosynthetic organisms.

AtpI works in concert with other subunits of the ATP synthase complex to couple the energy of the proton gradient established by photosynthetic electron transport to ATP synthesis. This energy conversion process is essential for supporting all cellular activities in the plant, making atpI a protein of significant interest for both basic research and applications in improving crop productivity.

What are the structural properties of recombinant atpI protein?

Recombinant Oryza sativa atpI is characterized by its membrane protein architecture optimized for proton translocation. According to product specifications, commercially available recombinant atpI has a purity of >85% as determined by SDS-PAGE analysis . The protein may be supplied in either lyophilized or liquid form with specific recommendations for storage and handling to maintain its structural integrity. When expressed recombinantly, the protein may include tags to facilitate purification, though the specific tag type is determined during the manufacturing process .

The native atpI protein features multiple transmembrane helices that anchor it within the membrane. These helical domains contain conserved amino acid residues that are critical for proton channel formation and function. The recombinant form may represent a partial sequence of the full protein, as indicated in product specifications , which should be considered when designing experiments.

Structural FeatureDescription
Protein LengthPartial (commercial recombinant product)
Purity>85% (SDS-PAGE)
Expression SystemYeast
Transmembrane DomainsMultiple hydrophobic α-helices
Post-translational ModificationsMay vary depending on expression system
UniProt IdentifierP0C2Y6

For structural studies, it's important to note that membrane proteins like atpI typically require specialized conditions for maintaining their native conformation, particularly the presence of appropriate detergents or lipid environments that mimic the thylakoid membrane.

How does atpI contribute to ATP synthesis in chloroplasts?

The atpI protein plays a specialized role in the mechanism of chloroplast ATP synthesis by forming a critical component of the proton channel within the membrane-embedded F0 sector of ATP synthase. During photosynthesis, light-driven electron transport establishes a proton gradient across the thylakoid membrane, with protons accumulating in the lumen. The atpI subunit, together with other components of the F0 sector, provides the pathway for these protons to flow back to the stromal side, following their electrochemical gradient.

The mechanism of atpI's contribution involves:

  • Proton channel formation: The transmembrane helices of atpI help create the pathway through which protons move across the membrane.

  • Interaction with the c-ring: AtpI contains specific residues that interact with the c subunits of the ATP synthase, facilitating the coupling of proton movement to rotation of the c-ring.

  • Energy conversion: The proton flow through the channel formed by atpI drives the rotary motion of the c-ring, which is transmitted to the central stalk of the F1 sector.

  • Structural support: AtpI provides stability to the entire ATP synthase complex, maintaining proper alignment of the stator and rotor components.

This process is fundamental to bioenergetics and has parallels to ATP synthesis in mitochondria, where similar energy conversion principles apply. Research using fluorescent protein biosensors for ATP has demonstrated that ATP synthesis and concentration vary significantly between different plant tissues and cell types, highlighting the dynamic nature of this essential process .

What are optimal storage conditions for recombinant atpI protein?

The stability and shelf life of recombinant Oryza sativa atpI protein depend critically on appropriate storage conditions. According to manufacturer guidelines, different forms of the protein require specific storage protocols to maintain functionality :

For lyophilized recombinant atpI:

  • Store at -20°C to -80°C for optimal stability

  • Expected shelf life under these conditions is approximately 12 months

  • Protect from moisture by storing with desiccant

  • Avoid frequent temperature fluctuations

For liquid recombinant atpI:

  • Store at -20°C to -80°C

  • Expected shelf life is approximately 6 months under these conditions

  • Divide into small working aliquots before freezing to minimize freeze-thaw cycles

  • Short-term working aliquots can be stored at 4°C for up to one week

The stability of the protein is influenced by multiple factors including buffer composition, storage temperature, and the inherent properties of the protein itself . For long-term storage of reconstituted protein, the addition of glycerol as a cryoprotectant (typically to a final concentration of 50%) is recommended . This prevents damage from ice crystal formation during freezing and helps maintain the protein's native structure.

Repeated freezing and thawing should be strictly avoided as this can lead to protein denaturation and loss of activity . If working with the protein over an extended period, it is advisable to monitor its activity at regular intervals using appropriate functional assays to ensure that it remains suitable for experimental use.

What methods should be used to verify the purity and functionality of recombinant atpI?

Comprehensive characterization of recombinant atpI requires a multi-faceted approach to assess both purity and functional integrity. The following methods should be implemented as part of a rigorous quality control process:

For purity assessment:

  • SDS-PAGE analysis: The manufacturer typically guarantees >85% purity by SDS-PAGE , but researchers should verify this independently. Use Coomassie blue or silver staining to visualize protein bands and assess purity.

  • Western blotting: Employ antibodies specific to atpI or to any affinity tags present on the recombinant protein to confirm identity and estimate purity.

  • Mass spectrometry: For precise verification of protein identity, sequence coverage, and detection of any post-translational modifications or degradation products.

  • Size exclusion chromatography: To evaluate protein homogeneity and detect potential aggregates or oligomeric states.

For functional assessment:

  • Reconstitution into liposomes: Incorporate atpI into artificial membrane systems with appropriate lipid composition to mimic the thylakoid membrane environment.

  • Proton translocation assays: Measure proton movement using pH-sensitive fluorescent dyes in reconstituted proteoliposomes containing atpI.

  • ATP synthesis measurements: When combined with other ATP synthase components, assess the ability to generate ATP using luminescence-based assays similar to those described for ATP flux measurements in mitochondria .

  • Binding assays: Verify interaction with other ATP synthase subunits using techniques such as co-immunoprecipitation or surface plasmon resonance.

A systematic approach to verification might include:

Assessment LevelTechniquesExpected Outcome
Primary structureMass spectrometryMatch to expected sequence
Secondary/tertiary structureCircular dichroismCharacteristic membrane protein spectra
Quaternary interactionsCrosslinking, co-IPBinding to partner subunits
Functional activityProton flux, ATP synthesisActivity comparable to native protein

Each of these methods provides complementary information about different aspects of protein quality, collectively offering a comprehensive assessment of recombinant atpI suitability for experimental applications.

How should recombinant atpI be reconstituted for experimental use?

Proper reconstitution of recombinant atpI is crucial for maintaining its structural integrity and functional activity. The following methodology represents best practices for preparing the protein for experimental applications:

  • Initial preparation:

    • Briefly centrifuge the vial containing lyophilized protein (30 seconds at 10,000 × g) to collect the material at the bottom of the tube.

    • Reconstitute in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL .

    • Allow complete dissolution through gentle mixing without vigorous vortexing, which can denature membrane proteins.

  • Buffer selection:

    • For functional studies, use buffers that mimic the physiological environment of the chloroplast stroma.

    • Typical buffer components include: 20-50 mM HEPES or Tricine (pH 7.5-8.0), 5-10 mM MgCl₂, 50-100 mM KCl, and 1-5 mM reducing agent (DTT or β-mercaptoethanol).

  • Stabilization for storage:

    • For long-term storage of reconstituted protein, add glycerol to a final concentration between 5-50% (with 50% being the manufacturer's standard recommendation) .

    • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

    • Flash-freeze aliquots in liquid nitrogen before transferring to -20°C or -80°C for storage.

  • Membrane protein considerations:

    • For functional studies, consider incorporating the protein into liposomes or nanodiscs to provide a membrane-like environment.

    • Use detergents at concentrations above their critical micelle concentration during initial handling, then remove or dilute them during reconstitution into membranes.

  • Quality control:

    • Verify protein concentration using appropriate methods for membrane proteins (modified Bradford or BCA assays).

    • Assess structural integrity before proceeding with experiments.

For experiments requiring active ATP synthase complexes, atpI must be reconstituted with other subunits of the F₀ and F₁ sectors in the correct stoichiometry and orientation. This complex reconstitution process may require additional specialized protocols developed for ATP synthase assembly.

How does atpI interact with other ATP synthase subunits?

The atpI protein engages in specific interactions with multiple ATP synthase subunits to form a functional enzyme complex capable of ATP synthesis. These interactions are essential for both the structural integrity of the complex and its mechanistic function in energy conversion.

The primary interactions include:

  • AtpI-c subunit interface: The transmembrane helices of atpI interact with the c-ring subunits to form the functional proton channel. This interface includes critical amino acid residues that facilitate proton transfer during rotary catalysis. The interaction is dynamic, allowing rotation of the c-ring while maintaining the proton path.

  • AtpI-b subunit association: AtpI binds to the b subunits, which form part of the peripheral stalk or stator. This interaction prevents rotation of the a subunit while allowing c-ring rotation, a crucial aspect of the ATP synthase mechanism.

  • Connections to the F₁ sector: Although not directly interacting with the catalytic F₁ portion, atpI contributes to the proper positioning of connecting elements between F₀ and F₁ sectors.

These interactions can be visualized in the following table:

Interaction PartnerInterface RegionFunctional Significance
c-ring subunitsTransmembrane helicesForms proton channel; essential for energy conversion
b subunitsPeripheral domainsCreates stator; maintains mechanical stability
Lipid bilayerHydrophobic surfaceEnsures proper membrane integration
δ and ε subunitsIndirect structural influenceAffects coupling of F₀ to F₁ rotation

The assembly of these subunits into a functional complex involves a coordinated process that maintains the correct stoichiometry and spatial arrangement. Disruption of these interactions through mutation or chemical modification severely impacts ATP synthesis capability. When conducting studies with recombinant atpI, these interaction requirements must be considered, particularly for functional reconstitution experiments.

What role does atpI play in plant stress responses?

While direct evidence specifically linking atpI to stress responses is limited in the provided search results, broader connections between ATP synthesis and plant stress adaptation can be established from ATP sensing studies and research on related proteins in rice.

The relationship between atpI function and stress responses can be understood through several mechanisms:

  • Energy homeostasis during stress: As a component of ATP synthase, atpI contributes to maintaining ATP levels under adverse conditions. Research using ATP sensing in living plant cells has revealed substantial plasticity of ATP homeostasis in seedlings under hypoxia , suggesting dynamic regulation of ATP synthesis pathways that would involve atpI.

  • Tissue-specific energy allocation: ATP mapping studies in Arabidopsis seedlings have highlighted different MgATP²⁻ concentrations between tissues and within individual cell types . This suggests that ATP synthase activity, including atpI function, may be differentially regulated in various tissues to support stress responses.

  • Signaling role: Changes in cellular energy status can trigger signaling cascades that activate stress response mechanisms. The ATP synthase complex may participate in sensing energy status changes during stress conditions.

Interestingly, research on rice lesion mimic mutants has shown that mutations in AAA-type ATPases can affect programmed cell death and disease resistance . While this involves a different type of ATPase than ATP synthase, it demonstrates the crucial link between ATP-utilizing enzymes and stress responses in rice. Plants with these mutations exhibited enhanced resistance to rice blast (Magnaporthe oryzae) and bacterial blight (Xanthomonas oryzae pv. oryzae) , suggesting complex interactions between energy metabolism and defense mechanisms.

Further research using approaches similar to those employed for ATP sensing in living plant cells could help elucidate the specific role of atpI in stress responses, particularly by examining how modifications to this subunit affect ATP dynamics under various stress conditions.

How is atpI expression and activity regulated in rice?

The regulation of atpI expression and activity involves multiple mechanisms that allow the plant to adjust ATP synthesis capacity in response to developmental and environmental cues. Though specific information on atpI regulation in rice is limited in the provided search results, several regulatory mechanisms can be inferred:

  • Transcriptional regulation:

    • Light-responsive elements likely control atpI expression, as ATP synthase is a key component of the photosynthetic apparatus

    • Developmental regulation ensures appropriate ATP synthase levels during different growth stages

    • Tissue-specific expression patterns may explain the ATP concentration gradients observed in different plant tissues

  • Post-translational modifications:

    • Phosphorylation sites on ATP synthase subunits can modulate activity in response to environmental signals

    • Redox regulation through thiol modifications may adjust ATP synthase function based on the chloroplast redox state

    • Protein-protein interactions with regulatory factors can fine-tune activity

  • Membrane environment regulation:

    • Lipid composition of the thylakoid membrane affects atpI function

    • Changes in membrane fluidity during temperature stress may impact atpI-mediated proton translocation

    • Thylakoid membrane organization (grana vs. stroma lamellae) influences ATP synthase distribution and activity

ATP sensing studies in Arabidopsis have shown that ATP levels differ significantly between tissues and respond dynamically to stresses like hypoxia . This suggests that the regulation of ATP synthase components, including atpI, must be sophisticated and responsive to changing conditions.

Experimental approaches to studying atpI regulation might include:

  • Promoter analysis to identify regulatory elements

  • Proteomic studies to detect post-translational modifications

  • Lipidomic analysis to correlate membrane composition with ATP synthase activity

  • Real-time monitoring of ATP levels using fluorescent biosensors under various conditions

Understanding these regulatory mechanisms is crucial for research aimed at modifying ATP synthase function for improved crop performance or stress tolerance.

How can atpI be used in ATP flux measurement studies?

Recombinant atpI can serve as a valuable component in sophisticated studies of ATP dynamics in plant systems, building on methodologies similar to those developed for ATP sensing in living plant cells. Several advanced approaches can be implemented:

  • Reconstituted systems for controlled ATP synthesis studies:

    • Purified recombinant atpI can be incorporated into proteoliposomes along with other ATP synthase subunits

    • These systems allow precise control over membrane composition, proton gradient magnitude, and other parameters

    • Systematic manipulation of individual components helps identify rate-limiting steps in ATP synthesis

  • Integration with fluorescent ATP biosensors:

    • Similar to the ATeam1.03-nD/nA biosensor described for measuring MgATP²⁻ in living plants

    • These FRET-based sensors can be calibrated under conditions appropriate for plant cytosol

    • Real-time detection of ATP synthesis provides kinetic information not accessible with endpoint assays

A methodological approach for such studies might include:

Experimental StageMethodologyExpected Outcome
System preparationReconstitution of atpI with ATP synthase componentsFunctional ATP synthase complex
Gradient establishmentAddition of ionophores to create proton gradientDriving force for ATP synthesis
Flux measurementFRET-based ATP biosensor monitoringReal-time ATP synthesis kinetics
Inhibitor studiesSequential addition of specific inhibitorsIdentification of rate-limiting steps

This methodology builds on the assay developed for ATP fluxes in isolated mitochondria , where researchers established conditions to selectively monitor ATP produced by ATP synthases and AAC activity. By exploiting differential sensitivity to ADP, it is possible to minimize contributions from other ATP-generating pathways .

For in planta studies, tissue-specific ATP gradients can be correlated with atpI expression or activity. Research has already demonstrated that ATP concentrations differ significantly between tissues and within individual cell types, such as root hairs . Understanding how atpI contributes to these gradients would provide valuable insights into plant bioenergetics and development.

What insights can atpI mutations provide for plant bioenergetics research?

Strategic mutations in the atpI gene offer powerful tools for understanding fundamental aspects of plant bioenergetics and developing novel research applications. The implications span from basic mechanistic studies to potential applications in crop improvement:

  • Structure-function analysis:

    • Site-directed mutations in key residues involved in proton translocation can reveal their specific roles

    • Mutational analysis of transmembrane helices can identify critical structural elements

    • Creation of chimeric proteins with subunits from different species can determine species-specific characteristics

  • Regulatory mechanism identification:

    • Mutations in potential regulatory sites can uncover control mechanisms

    • Analysis of how mutations affect ATP dynamics in different tissues can reveal tissue-specific regulation

    • Integration with ATP sensing techniques allows real-time assessment of how mutations affect ATP homeostasis

  • Bioenergetic adaptation studies:

    • Analysis of natural variants across rice cultivars may correlate with different growth conditions

    • Engineering of atpI variants with altered proton translocation properties can test hypotheses about energy efficiency

    • Investigation of how atpI mutations affect ATP gradients between tissues can provide insights into energy allocation

The approach to studying atpI mutations can be guided by research on other ATPases in rice. For example, studies on lesion mimic mutants identified a G-A base substitution causing premature translation termination in an AAA-type ATPase . This mutation affected programmed cell death and enhanced resistance to pathogens . While involving a different ATPase family, this research demonstrates how genetic modifications of ATPases can have profound physiological effects.

Methodologically, RNA interference approaches similar to those used in the lesion mimic resembling (lmr) studies could be applied to atpI. Additionally, complementation experiments expressing wild-type atpI in mutant backgrounds would confirm phenotypic effects are specifically due to atpI alterations.

How can atpI research contribute to improving rice photosynthetic efficiency?

Research on atpI has significant potential to contribute to strategies for enhancing photosynthetic efficiency in rice, addressing a critical goal for global food security. Several research pathways show promise:

Methodological approaches might include:

Research DirectionExperimental ApproachPotential Outcome
Natural variation analysisGenomic and phenotypic screening of diverse rice germplasmIdentification of beneficial atpI alleles
Directed evolutionIn vitro evolution of atpI followed by functional testingNovel variants with enhanced properties
Transgenic modificationPrecision engineering of atpI expression or structureRice lines with improved energy efficiency
ATP dynamics monitoringApplication of fluorescent ATP sensors in riceIdentification of energy-limiting conditions

This research would benefit from approaches similar to the expression of the REB transcriptional activator in rice grains , where researchers successfully expressed foreign genes in rice to enhance specific traits. The techniques for rice transformation and regeneration described in that study could be adapted for introducing modified atpI versions.

By building on our understanding of ATP dynamics in plants and applying this knowledge to rice-specific contexts, atpI research has substantial potential to contribute to the development of rice varieties with enhanced photosynthetic efficiency and productivity.

What are common challenges in experimental studies with recombinant atpI?

Working with recombinant Oryza sativa atpI presents several technical challenges that researchers should anticipate and address methodically. Understanding these challenges and implementing appropriate solutions is critical for successful experiments:

  • Protein solubility and aggregation issues:

    • Challenge: As a membrane protein, atpI has hydrophobic domains that can cause aggregation.

    • Solution: Use appropriate detergents for initial solubilization; reconstitute in lipid environments that mimic the native membrane; add glycerol (5-50%) to prevent aggregation during storage ; optimize buffer composition to enhance stability.

  • Maintaining native conformation:

    • Challenge: Loss of structural integrity during recombinant expression and purification.

    • Solution: Express at lower temperatures to slow folding; use gentle purification methods; verify structural integrity before functional studies; reconstitute in appropriate lipid environments.

  • Complex reconstitution difficulties:

    • Challenge: Achieving correct assembly with other ATP synthase subunits.

    • Solution: Establish step-wise reconstitution protocols; verify assembly using analytical techniques; ensure proper orientation in membrane systems.

  • Activity verification complications:

    • Challenge: Distinguishing specific atpI-dependent activity from background.

    • Solution: Use specific inhibitors to isolate ATP synthase contribution; implement controls for non-specific ATP production; develop selective assays based on the ATP sensing methodologies .

A systematic troubleshooting approach can include:

IssueDiagnostic MethodIntervention Strategy
Protein aggregationDynamic light scattering, size exclusion chromatographyOptimize detergent type/concentration; adjust buffer composition
Low puritySDS-PAGE, Western blotModify purification protocol; add additional purification steps
Poor complex assemblyBlue native PAGE, electron microscopyAdjust reconstitution conditions; verify component stoichiometry
Limited activityATP synthesis assaysTest different lipid compositions; optimize proton gradient conditions
Variable resultsStatistical analysis of replicatesStandardize protocols; increase technical and biological replicates

Incorporating quality control checkpoints throughout experimental workflows can significantly improve reproducibility. For storage-related issues, strictly adhering to the manufacturer's recommendations regarding temperature, freeze-thaw cycles, and use of preservatives will help maintain protein quality .

How should researchers analyze and interpret ATP synthesis data from atpI studies?

  • Experimental design considerations:

    • Include sufficient biological replicates (minimum n=3) and technical replicates

    • Implement appropriate positive and negative controls

    • Account for variables such as protein batch, reconstitution efficiency, and assay conditions

  • Quantitative analysis approaches:

    • For kinetic studies: Apply enzyme kinetic models (Michaelis-Menten, Hill equation) using non-linear regression

    • For comparative studies: Employ ANOVA with appropriate post-hoc tests (Tukey's, Bonferroni)

    • For inhibitor studies: Calculate IC50 values using dose-response curve fitting

  • Data normalization considerations:

    • Normalize activity to protein concentration or complex abundance

    • Consider normalizing to internal standards for multi-laboratory studies

    • Account for background ATP production in control samples

  • Addressing variability and conflicting results:

    • Conduct sensitivity analysis to identify parameters with greatest impact

    • Use meta-analysis approaches when integrating data from multiple experiments

    • When results conflict with published data, systematically evaluate methodological differences

Researchers can draw inspiration from ATP sensing studies in plants , which demonstrated approaches for calibrating ATP measurements under physiologically relevant conditions and analyzing ATP dynamics across different tissues. Similar methodologies can be adapted for in vitro studies with recombinant atpI.

For complex reconstitution experiments, additional analysis might include assessing the stoichiometry of ATP synthase components, orientation in membrane systems, and integrity of the proton gradient. When analyzing inhibitor studies, approaches similar to those used for mitochondrial ATP synthesis can help discriminate between different ATP-generating pathways and isolate the specific contribution of ATP synthase.

What are key considerations for designing experiments to study atpI function?

Designing robust experiments to investigate atpI function requires careful planning and attention to critical factors that influence outcomes. The following considerations provide a framework for developing effective experimental protocols:

  • Protein quality and preparation:

    • Verify purity and integrity before experiments (>85% purity by SDS-PAGE is standard)

    • Ensure consistent reconstitution protocols across experiments

    • Characterize each protein preparation before use in functional studies

    • Minimize freeze-thaw cycles by preparing appropriate aliquots

  • Membrane environment considerations:

    • Select lipid compositions that mimic the native thylakoid membrane

    • Control the protein-to-lipid ratio during reconstitution

    • Ensure proper orientation of atpI in membrane systems

    • Consider the influence of membrane potential on activity

  • Assay design factors:

    • Define appropriate buffer conditions (pH, ionic strength, Mg²⁺ concentration)

    • Establish sensitive and specific detection methods for ATP production

    • Include controls for background ATP synthesis or hydrolysis

    • Consider time-dependent changes in activity

  • Experimental controls:

    • Positive controls: native ATP synthase complexes or well-characterized reconstituted systems

    • Negative controls: heat-inactivated protein, systems lacking essential components

    • Specificity controls: selective inhibitors of different ATP-generating pathways

  • Data collection and analysis planning:

    • Determine appropriate sampling times based on preliminary kinetic studies

    • Plan statistical analysis methods before data collection

    • Ensure sufficient replication for robust statistical power

    • Consider both biological and technical variability sources

For advanced studies, researchers might adapt approaches from ATP sensing research in plant cells , which established methods for calibrating sensors under physiologically relevant conditions and monitoring ATP dynamics in different cellular contexts. These approaches could be modified for in vitro systems containing recombinant atpI.

When studying interactions with other ATP synthase components, techniques similar to those used for expression of foreign proteins in rice might be employed to create systems where tagged versions of atpI can be co-expressed with other subunits to facilitate interaction studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.