Recombinant Oryza sativa subsp. indica Bidirectional sugar transporter SWEET11 (SWEET11)

Shipped with Ice Packs
In Stock

Description

Gene Information and Synonyms

The SWEET11 gene in rice is known by several synonyms, reflecting its importance across multiple areas of rice research:

Gene SymbolSynonymsProtein Name
SWEET11OsSWEET11, Os8N3, XA13, OsI_30035Bidirectional sugar transporter SWEET11

This gene is notable for its disease-resistant allele Xa13, highlighting its dual role in both normal physiological processes and plant immunity .

Sugar Transport and Phloem Loading

SWEET11 functions as a bidirectional sugar transporter, mediating both low-affinity uptake and efflux of sugars across the plasma membrane . One of its primary physiological roles is in phloem loading, where it facilitates the export of sucrose from parenchyma cells. This function contributes to the H+-coupled import of sucrose into the sieve element/companion cell complex, which is essential for the migration of sugars from synthesis sites in the mesophyll to the phloem . This process is fundamental to the distribution of photosynthates throughout the plant.

Role in Seed Development and Filling

SWEET11 plays a crucial role in seed development and filling in rice. Expression analysis shows that OsSWEET11 mRNA levels are highest during the seed development phase, particularly between 7 and 14 days after pollination (DAP) . Unlike OsSWEET4, which predominantly functions during early stages of caryopsis development as a hexose transporter, OsSWEET11 expression gradually increases throughout seed development .

The protein localizes to four key sites during seed development:

  1. The nucellus proper at early developmental stages

  2. The ovular vascular trace

  3. The nuclear epidermis

  4. The endosperm

Studies with SWEET11 knockout mutants have demonstrated its essential role in seed filling. Rice plants with mutations in the OsSWEET11 gene (ossweet11) show:

  • Incompletely filled seeds at maturity

  • Delayed panicle development

  • Retention of chlorophyll in panicles even at 40 DAP

  • Significantly reduced yield, measured both by percentage of mature seeds and 1000-grain weight

The severity of these phenotypes increases under field conditions compared to greenhouse environments, though plant height, spikelet number, and panicle length remain comparable to wild-type plants .

Role in Plant-Pathogen Interactions

One of the most intriguing aspects of SWEET11 biology is its involvement in plant-pathogen interactions. Research has shown that the rice fungal pathogen Rhizoctonia solani, which causes sheath blight disease, induces the expression of OsSWEET11 in rice leaves . This upregulation appears to be a mechanism by which the pathogen acquires sugars from the host plant.

Experimental evidence supports this hypothesis:

  • Quantitative real-time PCR and β-d-glucuronidase expression analyses demonstrate that R. solani infection significantly enhances OsSWEET11 expression in leaves among the clade III SWEET members

  • Knockout mutants (Ossweet11) show reduced susceptibility to sheath blight disease

  • Plants overexpressing OsSWEET11 exhibit increased susceptibility to the disease

This relationship between SWEET11 expression and disease susceptibility has opened new avenues for engineering disease resistance in rice. Researchers have found that inhibiting OsSWEET11 function specifically in mesophyll cells, by expressing mutated OsSWEET11 under the control of the Rubisco promoter (active only in green tissues), improves resistance to sheath blight disease without negatively affecting yield production .

Production of Recombinant SWEET11

Recombinant full-length Oryza sativa subsp. indica Bidirectional Sugar Transporter SWEET11 protein can be produced in E. coli expression systems. Commercially available recombinant SWEET11 protein typically includes an N-terminal His-tag to facilitate purification and detection .

The specifications for commercially available recombinant SWEET11 include:

ParameterSpecification
SourceE. coli
TagHis
Protein LengthFull Length (1-307 amino acids)
FormLyophilized powder
Purity>90% (determined by SDS-PAGE)
Storage-20°C/-80°C, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol

Research Applications

Recombinant SWEET11 protein has several important applications in rice research:

  1. Structural and functional studies: The purified protein can be used to investigate the structural features that enable bidirectional sugar transport.

  2. Protein-protein interaction studies: Recombinant SWEET11 is valuable for studying interactions with other proteins involved in sugar transport and metabolism, as well as with pathogen effectors.

  3. Antibody production: The protein can be used to generate antibodies for immunolocalization and Western blot analysis to study SWEET11 expression and localization in plant tissues.

  4. Sugar transport assays: In vitro assays using recombinant SWEET11 can help characterize its sugar transport properties and specificities.

Genetic Manipulation of SWEET11

Several approaches have been used to study SWEET11 function through genetic manipulation:

CRISPR-Cas9 and TALEN Technologies

Researchers have successfully created ossweet11 mutants using both CRISPR-Cas9 and TALEN (Transcription Activator-Like Effector Nuclease) technologies:

  • CRISPR-Cas9 has been used to create mutations such as single nucleotide deletions leading to frameshifts in the SWEET11 gene

  • TALEN-derived mutants carrying larger deletions (e.g., 489 bp) have also been generated

These genetic tools have been invaluable for studying the physiological roles of SWEET11 in rice development and its involvement in pathogen interactions.

Expression Systems

To study SWEET11 expression patterns, researchers have developed transgenic rice lines expressing reporter genes under the control of the SWEET11 promoter:

  • Constructs such as pOsSWEET11:gOsSWEET11-GUSplus have been used to transform rice varieties like Kitaake

  • These reporter lines allow for histochemical analysis of SWEET11 expression in different tissues and developmental stages

Additionally, SWEET11 overexpression lines have been created to study the effects of increased SWEET11 activity on plant development and pathogen susceptibility .

Enhancing Disease Resistance

The discovery that SWEET11 is involved in susceptibility to sheath blight disease has led to innovative approaches for enhancing disease resistance in rice. One promising strategy involves tissue-specific inhibition of SWEET11 function:

  • By expressing mutated SWEET11 under the control of the Rubisco promoter, which is active only in green tissues

  • This approach inhibits SWEET11-mediated sugar efflux specifically in mesophyll cells

  • The result is improved resistance to sheath blight disease without affecting normal grain filling

This targeted approach represents a significant advancement over complete knockout of SWEET11, which, while improving disease resistance, also negatively impacts yield.

Optimizing Seed Development

Understanding the role of SWEET11 in seed filling has important implications for crop improvement:

  • The identification of SWEET11 as a key player in endosperm development offers potential targets for enhancing grain size and quality

  • Studies with double mutants (ossweet11;15) have shown more severe phenotypes with empty seeds, indicating potential redundancy and complementary functions between different SWEET transporters

  • This knowledge can guide breeding programs aiming to optimize grain filling without compromising other aspects of plant development

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SWEET11; Os8N3; XA13; OsI_30035; Bidirectional sugar transporter SWEET11; OsSWEET11; Disease resistant allele Xa13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
SWEET11
Target Protein Sequence
MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSV LWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRARLRTLAFFLLLDVAAFALI VVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSA VAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAA ATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELLQNKPEV IEITAAV
Uniprot No.

Target Background

Function
SWEET11, a bidirectional sugar transporter from *Oryza sativa* subsp. *indica*, mediates both low-affinity sugar uptake and efflux across the plasma membrane. It is essential for pollen viability. In its Xa13 allelic form (e.g., cv. IR24), it confers sensitivity to bacterial blight caused by *Xanthomonas oryzae* pv. *oryzae* (Xoo), likely by providing sugars necessary for pathogen growth. Conversely, a recessive resistance can be associated with the xa13 allele (where promoter mutation reduces induction upon pathogen infection, e.g., cv. IRBB13), specifically against Xoo Philippine race 6 and Indian race PXO8.
Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Mostly expressed in panicles and anthers. Also detected at low levels in leaves and roots.

Q&A

What is SWEET11 and what is its primary function in rice?

SWEET11 (also known as OsSWEET11) is a bidirectional sugar transporter protein found in rice (Oryza sativa) that mediates the efflux and influx of sucrose across cell membranes. It belongs to the SWEET (Sugars Will Eventually be Exported Transporters) family. The primary function of SWEET11 in rice is facilitating sucrose transport during seed development, playing a crucial role in the apoplasmic pathway of seed filling. SWEET11 works in conjunction with SWEET15 to enable the transfer of photosynthetically-derived sucrose from source tissues to developing grains, which is essential for proper endosperm development and ultimately grain yield .

Where is SWEET11 expressed in rice tissues and at what developmental stages?

SWEET11 exhibits tissue-specific and developmentally regulated expression patterns in rice. Research using mRNA quantification and histochemical analyses has revealed that SWEET11 is primarily expressed in:

  • The nucellus proper during early developmental stages

  • The nucellar projection close to the dorsal vein

  • The nucellar epidermis surrounding the endosperm

  • The aleurone layer

SWEET11 shows preferential expression in sink tissues, particularly in the developing spikelet and endosperm, while SWEET13 and SWEET14 exhibit more source-specific expression patterns (primarily in flag leaves and stems) . The temporal expression pattern of SWEET11 correlates with critical periods of grain filling, with peak expression occurring during the early to mid stages of caryopsis development .

What are the recommended methods for producing recombinant SWEET11 protein?

Production of recombinant SWEET11 protein requires careful consideration of expression systems due to its transmembrane nature. The recommended methodology includes:

  • Gene optimization and vector selection:

    • Codon optimization for the chosen expression system

    • Use of vectors containing strong promoters (e.g., T7 for bacterial systems)

    • Addition of purification tags (His-tag, GST-tag) for downstream purification

  • Expression systems options:

    • Bacterial systems (E. coli) for protein fragment expression

    • Yeast systems (P. pastoris) for functional full-length protein

    • Insect cell systems (Sf9) for mammalian-like post-translational modifications

  • Purification strategy:

    • Cell lysis using detergents suitable for membrane proteins

    • Affinity chromatography using the chosen tag

    • Size exclusion chromatography for final purification

  • Quality control:

    • SDS-PAGE to confirm molecular weight (approximately 33 kDa)

    • Western blotting with anti-SWEET11 antibodies

    • Activity assays using radioactively labeled or fluorescent sucrose analogs

Standard storage conditions include 50% glycerol in Tris-based buffer at -20°C or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles .

How can SWEET11 expression be accurately quantified in rice tissues?

Accurate quantification of SWEET11 expression requires a multi-method approach:

  • Transcriptional level analysis:

    • Quantitative real-time PCR (qRT-PCR) using SWEET11-specific primers

    • RNA-seq for genome-wide expression profiling

    • Use of reference genes such as OsActin or OsUbiquitin for normalization

  • Protein level analysis:

    • Western blotting with specific anti-SWEET11 antibodies

    • ELISA for quantitative protein determination

    • Proteomics approaches using mass spectrometry

  • Spatial expression analysis:

    • In situ hybridization for tissue-specific localization

    • Immunohistochemistry using anti-SWEET11 antibodies

    • Translational promoter-reporter fusions (e.g., SWEET11 promoter::GFP)

For developmental studies, time-course analysis during caryopsis development is essential, with sampling at key developmental stages (early, mid, and late grain filling). When comparing different rice varieties or treatments, standardized cultivation conditions and tissue sampling protocols are critical for reliable results .

What CRISPR/Cas9 strategies have been effective for generating SWEET11 knockout mutants?

Effective CRISPR/Cas9 strategies for generating SWEET11 knockout mutants include:

  • Target site selection:

    • Target early exons to ensure complete loss of function

    • Select sites with high specificity scores to minimize off-target effects

    • Common targets include the first and second exons of the SWEET11 gene

  • Guide RNA design:

    • Design 2-3 sgRNAs targeting different regions for higher efficiency

    • Ensure PAM sequence availability (NGG for SpCas9)

    • Verify target specificity using tools like CRISPR-P or CRISPOR

  • Vector construction:

    • Use rice-optimized vectors like pHUE411 for higher expression efficiency

    • Include selection markers (hygromycin resistance) for transgenic plant screening

    • Consider multiplex systems for simultaneous targeting of SWEET11 and SWEET15

  • Transformation and screening:

    • Agrobacterium-mediated transformation of rice callus

    • Regeneration under selection pressure

    • PCR-based genotyping followed by Sanger sequencing to confirm mutations

    • T7 endonuclease I assay for rapid mutation detection

For functional analysis, researchers have successfully created ossweet11;15 double knockout lines to study the combinatorial effects of these transporters on seed filling. These double mutants showed starch accumulation in the pericarp while caryopses lacked functional endosperm, demonstrating the essential role of these transporters in seed development .

How does SWEET11 contribute to the seed filling process in rice?

SWEET11 plays a critical role in the apoplasmic seed filling pathway through the following mechanisms:

  • Sucrose efflux at the maternal-filial interface:

    • Facilitates sucrose release from maternal tissues into the apoplasmic space

    • Functions specifically at the nucellar projection near the dorsal vein

    • Works in conjunction with SWEET15 to ensure adequate carbohydrate supply

  • Nucellar epidermis/aleurone interface transfer:

    • Mediates sucrose movement across the boundary between maternal (nucellar) and filial (aleurone/endosperm) tissues

    • Creates a sucrose gradient that drives subsequent active transport processes

  • Temporal regulation of sugar availability:

    • Expression patterns coincide with key stages of endosperm development

    • Ensures continuous supply of carbohydrates throughout grain filling period

Research using knockout mutants has demonstrated that SWEET11 and SWEET15 are essential for proper endosperm development. In ossweet11;15 double knockout lines, starch abnormally accumulates in the pericarp, while the caryopses fail to develop functional endosperm, highlighting the critical nature of these transporters in directing carbohydrate flow to developing seeds .

What is the relationship between SWEET11 and bacterial blight resistance in rice?

SWEET11 has a complex relationship with bacterial blight resistance in rice:

  • Susceptibility mechanism:

    • The bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo) uses transcription activator-like effectors (TALEs) to induce SWEET gene expression

    • Upregulation of SWEET11 increases sugar availability in the apoplast, providing nutrients for bacterial growth

    • This represents a susceptibility mechanism that the pathogen exploits

  • Resistance strategies:

    • Natural resistance involves mutations in the SWEET11 promoter that prevent TALE binding

    • The recessive resistance gene xa13 is an allele of SWEET11 with promoter variations that prevent pathogen-induced expression

    • Genome editing approaches have created resistance by modifying the effector-binding elements in SWEET promoters

  • Engineering resistance:

    • CRISPR/Cas9 has been used to modify SWEET gene promoters without affecting their developmental functions

    • Targeted mutations in effector-binding elements (EBEs) prevent TALE binding while maintaining normal developmental expression patterns

This understanding has led to new strategies for engineering disease resistance in rice by modifying SWEET promoters rather than eliminating the genes completely, preserving their essential developmental functions while preventing pathogen exploitation .

How do SWEET11 expression patterns differ between indica and japonica rice subspecies?

Comparative studies have revealed distinct expression patterns of SWEET11 between indica and japonica rice subspecies:

ParameterIndica SubspeciesJaponica Subspecies
Expression level in flag leafModerateLow
Expression level in stemLowLow
Expression in developing endospermHighHigh
Expression in spikeletVery highHigh
Cold-stress responseLimited upregulationSignificant upregulation
Drought-stress responseModerate downregulationStrong downregulation
Diurnal regulationStrongModerate

How can SWEET11 be utilized in improving rice yield potential?

SWEET11 offers several avenues for improving rice yield potential:

  • Optimizing seed filling efficiency:

    • Fine-tuning SWEET11 expression levels to enhance sucrose transport during grain filling

    • Creating rice varieties with optimized promoters that increase SWEET11 expression specifically during grain development

    • Balancing source-sink relationships through coordinated expression of SWEET transporters

  • Engineering stress tolerance:

    • Developing varieties with stress-responsive SWEET11 expression to maintain carbohydrate supply under suboptimal conditions

    • Creating conditional expression systems that increase SWEET11 activity during recovery from stress events

    • Coupling SWEET11 expression with osmotic adjustment mechanisms

  • Enhancing nutrient use efficiency:

    • Coordinating SWEET11 expression with nitrogen uptake to optimize carbon-nitrogen balance

    • Improving post-flowering carbohydrate remobilization through SWEET11 regulation

  • Implementation strategies:

    • Traditional breeding approaches utilizing natural variation in SWEET11 promoter and coding sequences

    • Precision genome editing of SWEET11 regulatory elements

    • Development of transgenic lines with tissue-specific SWEET11 overexpression

Research has shown that rice varieties with optimized SWEET11 expression patterns can show improved grain filling rates, increased thousand-grain weight, and enhanced yield stability across diverse environments .

What are the current challenges in studying SWEET11 transporter kinetics?

Researchers face several challenges when studying SWEET11 transporter kinetics:

  • Technical limitations:

    • Difficulty in purifying functional membrane proteins while maintaining native conformation

    • Challenges in reconstituting transporters in artificial membrane systems

    • Limited availability of radioactively labeled or fluorescent sucrose analogs for transport assays

  • Biological complexities:

    • Compensatory mechanisms through other SWEET family members

    • Interaction with other sugar transporters (e.g., SUTs) in planta

    • Post-translational modifications affecting transport activity

    • Influence of membrane lipid composition on transport efficiency

  • Experimental approaches to overcome challenges:

    • Use of heterologous expression systems (Xenopus oocytes, yeast)

    • Development of fluorescence-based assays for real-time transport monitoring

    • Application of electrophysiological techniques to measure transport activity

    • Computational modeling of transport kinetics based on structural data

  • Emerging methodologies:

    • Single-molecule tracking to analyze transporter dynamics in membranes

    • FRET-based biosensors for monitoring substrate binding and conformational changes

    • Cryo-electron microscopy for structural analysis of membrane transporters

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, biophysics, and computational modeling to fully understand SWEET11 transport mechanisms and kinetics.

How does SWEET11 interact with other sugar transporters in the rice phloem loading pathway?

SWEET11 functions within a complex network of sugar transporters in the rice phloem loading pathway:

  • Coordination with other SWEET transporters:

    • SWEET11 works synergistically with SWEET15 in seed filling processes

    • SWEET13 and SWEET14 operate primarily in source tissues (leaves and stems)

    • Functional redundancy exists among certain SWEET family members, allowing compensation when individual transporters are compromised

  • Interaction with SUT/SUC transporters:

    • SWEET11 mediates sucrose efflux into the apoplast, providing substrate for SUT1/SUC2 transporters

    • SUT1/SUC2 transporters then actively transport sucrose into the phloem companion cell-sieve element complex

    • This two-step process is essential for efficient phloem loading in apoplasmic loaders like rice

  • Regulatory crosstalk:

    • Expression of SWEET11 and SUT transporters is coordinately regulated during development

    • Sucrose levels in the apoplast provide feedback regulation for both transporter families

    • Hormone signals (especially auxins and cytokinins) modulate the expression of both transporter types

  • Metabolic integration:

    • SWEET11 activity is linked to sucrose synthase and invertase activities in sink tissues

    • Cell wall invertases in the apoplast can modify the sucrose gradient established by SWEET transporters

    • This integrated system ensures appropriate sugar distribution based on developmental and environmental signals

This complex interplay between different sugar transporter families enables the fine-tuned control of carbohydrate partitioning that is essential for optimal plant growth and development.

What new insights have genome editing approaches provided about SWEET11 function?

Genome editing approaches, particularly CRISPR/Cas9 technology, have provided several key insights about SWEET11 function:

  • Functional dissection:

    • Precise knockout of SWEET11 alone versus SWEET11/SWEET15 double knockouts has revealed both unique and overlapping functions

    • Targeted mutagenesis of specific protein domains has identified critical regions for transport function

    • Promoter editing has distinguished between developmental and pathogen-responsive elements

  • Disease resistance applications:

    • Editing of effector-binding elements (EBEs) in SWEET11 promoters has created bacterial blight-resistant rice varieties

    • These modified plants maintain normal developmental expression while preventing pathogen-induced overexpression

    • This represents a significant advance in understanding the dual role of SWEET11 in development and disease

  • Regulatory insights:

    • Base editing of cis-regulatory elements has revealed how SWEET11 expression is fine-tuned during development

    • Identification of tissue-specific enhancers that control SWEET11 expression in different cell types

    • Discovery of stress-responsive elements that modulate expression under environmental challenges

  • Methodological advances:

    • Development of CRISPR/Cas9 vectors optimized for rice transformation (e.g., pHUE411)

    • Successful strategies for creating knockout mutants using dual sgRNAs targeting different exons

    • Precise editing of promoter sequences without disrupting gene function

These genome editing approaches have transformed our understanding of SWEET11 function by enabling precisely targeted modifications that were previously impossible with conventional mutagenesis techniques.

How is SWEET11 involved in rice responses to environmental stresses?

SWEET11 plays important roles in rice responses to various environmental stresses:

  • Cold stress response:

    • SWEET11 expression is modulated during cold stress, affecting carbohydrate partitioning

    • In cold-tolerant japonica varieties, SWEET11 works alongside CTB3, OsTPP1, and other sugar transporters

    • This coordinated response helps maintain sugar transport to developing tissues during cold stress

    • Knockout studies of ossweet11b suggest its involvement in cold tolerance mechanisms at the booting stage

  • Drought stress adaptation:

    • SWEET11 expression patterns shift during drought, prioritizing reproductive tissue sugar supply

    • This helps maintain grain filling even under water-limited conditions

    • Integration with ABA signaling pathways affects SWEET11 regulation during water deficit

  • Biotic stress interactions:

    • Beyond bacterial blight, SWEET11 expression changes in response to other pathogens

    • Fungal pathogens can also manipulate sugar transport through effects on SWEET gene expression

    • The sugar status of tissues, partially controlled by SWEET11, influences defense compound synthesis

  • Nutritional stress responses:

    • SWEET11 expression responds to changes in nitrogen availability

    • Carbon/nitrogen balance is maintained through coordinated regulation of sugar and nitrogen transporters

    • Phosphorus deficiency alters SWEET11 expression patterns to optimize resource allocation

Understanding these stress-response mechanisms provides opportunities for developing climate-resilient rice varieties through targeted modification of SWEET11 and related sugar transport systems.

What are the most promising research directions for understanding SWEET11 structure-function relationships?

The most promising research directions for understanding SWEET11 structure-function relationships include:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy to determine high-resolution structures of SWEET11 in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic aspects of transporter function

    • Molecular dynamics simulations based on structural data to understand transport mechanisms

    • Site-directed spin labeling and EPR spectroscopy to analyze conformational changes during transport

  • Protein engineering strategies:

    • Structure-guided mutagenesis to identify critical residues for substrate specificity

    • Domain swapping experiments between different SWEET transporters to identify functional domains

    • Creation of chimeric transporters with altered substrate specificity or transport kinetics

    • Development of regulatable SWEET11 variants for controlled expression studies

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

    • Network analysis of sugar transport and metabolism under different conditions

    • Mathematical modeling of whole-plant sugar transport incorporating SWEET11 kinetics

    • Identification of SWEET11 interacting partners that modulate its activity

  • Translational research:

    • Application of structure-function knowledge to design improved SWEET11 variants

    • Development of small molecule modulators of SWEET11 activity based on structural insights

    • Creation of biosensors based on SWEET11 conformational changes for monitoring sugar flux

    • Targeted modification of SWEET11 to enhance yield stability under changing environments

These research directions hold significant potential for advancing our understanding of SWEET11 function and developing innovative strategies for crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.