Recombinant Oryza sativa subsp. indica Bidirectional sugar transporter SWEET14 (SWEET14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. indica Bidirectional Sugar Transporter SWEET14

Recombinant Oryza sativa subsp. indica Bidirectional sugar transporter SWEET14 is a recombinant protein derived from the SWEET14 gene in rice. This protein is part of the SWEET family, which plays a crucial role in sugar transport across cell membranes in plants. The SWEET transporters are known for their ability to facilitate the movement of sugars such as sucrose, glucose, and fructose, which are essential for plant growth and development.

Characteristics of SWEET14

  • Function: SWEET14 is primarily involved in the bidirectional transport of sugars, meaning it can move sugars both into and out of cells.

  • Species: Derived from Oryza sativa subsp. indica, a subspecies of rice.

  • Protein Structure: Typically consists of seven transmembrane domains (TMDs) forming two MtN3/Saliva domains, which are characteristic of SWEET proteins.

  • Substrate Specificity: While primarily transporting sucrose, SWEET14 can also transport other sugars like glucose and fructose.

Research Findings on SWEET14

Research on SWEET14 has highlighted its importance in plant sugar metabolism and its potential applications in agriculture. Here are some key findings:

Recombinant Protein Production and Applications

The recombinant SWEET14 protein is produced using biotechnological methods, often for research purposes. Here are some details about its production and potential applications:

  • Production Method: Typically involves cloning the SWEET14 gene into an expression vector and expressing it in a host organism like bacteria or yeast.

  • Product Specifications: Available as a recombinant protein in quantities such as 50 µg, stored in a Tris-based buffer with 50% glycerol, and should be kept at -20°C for long-term storage .

  • Applications: Used in research to study sugar transport mechanisms, plant development, and disease resistance. It may also have potential applications in improving crop yields and stress tolerance.

Table 1: Characteristics of Recombinant SWEET14 Protein

CharacteristicDescription
SpeciesOryza sativa subsp. indica
FunctionBidirectional sugar transport
Substrate SpecificitySucrose, glucose, fructose
Storage Conditions-20°C in Tris-based buffer with 50% glycerol
Quantity Available50 µg (other quantities available)

Table 2: Research Applications of SWEET14

ApplicationDescription
Disease ResistanceStudying resistance to bacterial blight in rice
Sugar TransportUnderstanding mechanisms of sugar movement in plants
Stress ToleranceInvestigating potential roles in stress response

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SWEET14; Os11N3; OsI_36230; Bidirectional sugar transporter SWEET14; OsSWEET14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
SWEET14
Target Protein Sequence
MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSA AGVKEHVVNIAKLSAAVDVVKTREVHPVDVESPPAEAPPQEDDKAAAATAAAVAGAGEKK VAA
Uniprot No.

Target Background

Function
Mediates both low-affinity uptake and efflux of sugars across the plasma membrane.
Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET14 and what is its function in rice plants?

SWEET14 (also known as Os11N3) belongs to the SWEET (Sugars Will Eventually be Exported Transporters) family and functions as a bidirectional uniporter that facilitates sugar diffusion across cell membranes along concentration gradients. Unlike other sugar transporters that require coupling with H+ ions, SWEET proteins can transport sugar in both directions independent of pH value .

In rice plants, SWEET14 serves multiple physiological roles, with significant involvement in pathogen interactions. It encodes a sugar transporter that mediates glucose and sucrose export to the apoplast, potentially providing nutrients to pathogens during infection . This function makes it a critical susceptibility factor, particularly in rice-Xanthomonas interactions.

What is the role of SWEET14 in plant-pathogen interactions?

SWEET14 serves as a major susceptibility factor during rice-Xanthomonas oryzae pv. oryzae (Xoo) interactions. During infection, Xoo bacteria inject transcription activator-like effectors (TALEs) into rice cells, which bind to specific effector-binding elements (EBEs) in the SWEET14 promoter region, inducing gene expression .

The resulting upregulation of SWEET14 leads to increased sugar transport to the apoplast, creating a nutrient-rich environment that benefits the bacterial pathogen. What makes SWEET14 particularly significant is that it is targeted by multiple, phylogenetically distinct Xoo strains through different TALEs (AvrXa7, PthXo3, Tal5, and TalC), highlighting its central importance in bacterial pathogenesis .

How does SWEET14 differ from other sugar transporters in plants?

SWEET14 displays several distinctive characteristics compared to other well-characterized sugar transporters:

FeatureSWEET14/SWEET FamilyMSTs/SUTs
Transport mechanismBidirectional uniporters/facilitatorsUnidirectional transporters
Energy dependencyTransport along concentration gradient (no direct energy requirement)Require coupling with H+ gradient (energy-dependent)
pH sensitivityFunction independent of pHActivity influenced by pH due to proton coupling
DirectionalityCapable of both import and exportTypically transport in one direction
StructureMultiple transmembrane domains forming a poreCarrier proteins with substrate binding domains

These distinct properties make SWEET transporters uniquely suited for specific physiological roles in plants, particularly in contexts requiring bidirectional sugar movement .

What gene family does SWEET14 belong to and how is it evolutionarily related to other SWEET proteins?

SWEET14 belongs to the SWEET gene family, specifically to clade III along with SWEET11 and SWEET13. These clade III SWEETs have been shown to act as susceptibility genes in plant-pathogen interactions across rice varieties .

The SWEET family is evolutionarily conserved across plant species, indicating fundamental importance in plant physiology. The family has expanded through gene duplication events during plant evolution, resulting in paralogs with specialized functions in different tissues and developmental contexts .

A remarkable evolutionary aspect is the convergent targeting of SWEET14 by multiple, phylogenetically distinct Xoo strains, where different pathogens have independently evolved to target the same host susceptibility factor. This convergent evolution underscores SWEET14's pivotal role in providing nutrients to pathogens .

How can SWEET14 be targeted for genome editing to confer resistance to Xanthomonas oryzae pv. oryzae?

Genome editing of the SWEET14 promoter region represents a promising strategy for developing Xoo-resistant rice varieties. The methodological approach typically involves:

  • Identifying specific EBEs in the SWEET14 promoter targeted by relevant Xoo strains' TALEs

  • Designing TALEN (Transcription Activator-Like Effector Nuclease) pairs to target sequences flanking each EBE

  • Cloning TALEN pairs into binary vectors for Agrobacterium-mediated transformation

  • Introducing TALENs into rice plants to create double-strand breaks at target sites

  • Screening transformed plants for mutations disrupting EBE sequences

  • Evaluating edited plants' resistance against Xoo strains

Research has demonstrated that disruption of AvrXa7- and Tal5-EBEs in the SWEET14 promoter can render rice plants resistant to Xoo strains dependent on these TALEs. For example, Kitaake edited lines carrying sweet14-10 (28-bp deletion) and sweet14-11 (33-bp deletion) alleles showed abolished SWEET14 induction when challenged with PXO86, which relies on AvrXa7 .

Interestingly, modifications of the TalC EBE failed to confer resistance to TalC-dependent bacteria, suggesting this TALE may activate additional susceptibility genes beyond SWEET14 .

What methodological approaches are effective for studying SWEET14 function in rice?

Several complementary approaches provide insights into SWEET14 function:

  • Gene expression analysis: Quantitative PCR to measure SWEET14 expression levels in different tissues, developmental stages, or in response to pathogen infection

  • Protein localization studies: GFP fusion constructs and immunolocalization to determine subcellular localization patterns

  • Transport assays: In vitro and in vivo sugar transport assays to characterize substrate specificity, transport kinetics, and directionality

  • Genetic approaches:

    • Genome editing using TALEN or CRISPR/Cas9 systems to generate loss-of-function mutants or modify regulatory elements

    • Overexpression studies to assess increased SWEET14 activity effects

    • Complementation assays in mutant backgrounds to confirm gene function

  • Recombinant protein studies: Production of His-tagged SWEET14 for structural studies, protein-protein interaction assays, or in vitro transport assays

  • Pathogen challenge assays: Inoculation with different Xoo strains to assess SWEET14's role in susceptibility or resistance

  • Sugar content analysis: Measuring sugar levels in different plant tissues or the apoplast to correlate with SWEET14 expression

How do different TALEs (transcription activator-like effectors) interact with the SWEET14 promoter region?

The interaction between TALEs and the SWEET14 promoter represents a fascinating example of plant-pathogen co-evolution. Several TALEs from phylogenetically distinct Xoo strains target SWEET14:

  • AvrXa7 from strain PXO86 (Philippines)

  • PthXo3 from strain PXO61 (Philippines)

  • Tal5 from strain MAI1 (Mali)

  • TalC from strain BAI3 (Burkina Faso)

These TALEs recognize specific effector-binding elements (EBEs) in the SWEET14 promoter. The EBEs recognized by AvrXa7, PthXo3, and Tal5 overlap, while the TalC EBE is located upstream from these overlapping regions .

Each TALE contains repeat-variable diresidues (RVDs) that recognize specific DNA bases in their corresponding EBEs. When bound to these elements, TALEs recruit transcriptional machinery to activate SWEET14 expression. Disrupting these EBEs through genome editing can prevent TALE binding and subsequent gene induction, as demonstrated with the AvrXa7/Tal5 EBE region .

The TalC case is more complex, as modifications of its EBE did not confer resistance to TalC-dependent bacteria, suggesting it may induce additional susceptibility genes beyond SWEET14 .

What are the implications of SWEET14 mutations on rice resistance to bacterial pathogens?

SWEET14 mutations, particularly in its promoter region, have significant implications for rice resistance:

  • Enhanced resistance: Mutations disrupting EBEs in the SWEET14 promoter can prevent TALE-mediated induction, conferring resistance to Xoo strains dependent on those TALEs. Rice lines with mutations in the AvrXa7/Tal5 EBE region showed significant resistance to strains using these TALEs .

  • Strain-specific resistance: Since different Xoo strains employ different TALEs, mutations in specific EBEs confer resistance only to strains relying on those particular TALEs. For instance, AvrXa7 EBE mutations would not protect against strains using TalC .

  • Broad-spectrum resistance potential: By editing multiple EBEs in the SWEET14 promoter or combining SWEET14 edits with modifications in other SWEET genes (SWEET11, SWEET13), researchers have developed rice varieties with broader resistance to multiple Xoo strains .

  • Recessive resistance mechanism: SWEET14 promoter mutations represent a form of recessive resistance where the pathogen loses the ability to induce a susceptibility factor, contrasting with dominant R gene-mediated resistance .

  • Complex outcomes: In some cases, such as with TalC, mutations in the EBE did not confer resistance, suggesting more complex interaction networks where multiple susceptibility genes may be involved .

These findings demonstrate the potential of SWEET14 promoter editing as a strategy for developing bacterial blight-resistant rice varieties with potentially more durable resistance than traditional approaches .

How can recombinant SWEET14 protein be used in experimental studies?

Recombinant SWEET14 protein serves as a valuable tool for diverse experimental applications:

  • Structural studies: Purified protein can be used for X-ray crystallography or cryo-electron microscopy to determine three-dimensional structure and transport mechanism

  • Biochemical characterization:

    • Substrate specificity studies to identify transportable sugars

    • Kinetic analyses measuring transport rates under various conditions

    • Inhibitor screening to identify molecules blocking SWEET14 activity

  • Protein-protein interaction studies:

    • Pull-down assays identifying SWEET14-interacting proteins

    • Co-immunoprecipitation confirming interactions in vivo

    • Yeast two-hybrid screens discovering novel interaction partners

  • Antibody production: For immunolocalization, western blotting, or immunoprecipitation experiments

  • In vitro transport assays: Reconstituting SWEET14 in liposomes to study transport properties in controlled environments

The commercially available recombinant SWEET14 is produced in E. coli with an N-terminal His tag, provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Storage recommendations typically include keeping working aliquots at 4°C for up to one week, with longer-term storage at -20°C/-80°C, avoiding repeated freeze-thaw cycles .

What are the differences between African and Asian Xoo strains in their targeting of SWEET14?

African and Asian Xanthomonas oryzae pv. oryzae strains exhibit distinct evolutionary patterns in their SWEET gene targeting strategies:

FeatureAfrican Xoo StrainsAsian Xoo Strains
TALEs usedTalC and TalFPthXo1, PthXo2 variants, PthXo3, AvrXa7
Target genesPrimarily SWEET14Multiple SWEET genes (SWEET11a, SWEET13, SWEET14)
EBE location in SWEET14TalC recognizes an upstream EBEAvrXa7, PthXo3 target different, overlapping EBEs
Virulence mechanismsTalC may have broader activityMore specialized in targeting specific SWEET genes

These differences reflect the phylogenetic distinction between African and Asian Xoo populations that evolved separately in different geographic regions . Understanding these regional variations is crucial for developing effective resistance strategies:

  • For African strains, editing the TalC and TalF EBEs in SWEET14 would be essential

  • For Asian strains, a broader approach targeting EBEs in multiple SWEET genes would be necessary for comprehensive resistance

These patterns of adaptive evolution demonstrate the importance of regionally-appropriate resistance breeding strategies based on local pathogen populations.

What methodological challenges exist in studying SWEET14 function in rice?

Researchers face several significant challenges when investigating SWEET14:

  • Functional redundancy: Multiple SWEET family members with potentially overlapping functions complicate isolating SWEET14's specific role. SWEET11, SWEET13, and SWEET14 all belong to clade III and can function as susceptibility factors .

  • Protein characterization difficulties:

    • Membrane protein purification and crystallization challenges

    • Complex reconstitution requirements for functional assays

    • Bidirectional transport kinetics that are technically difficult to measure

  • Pathogen interaction complexity:

    • Multiple TALEs targeting the same gene with different binding sites

    • Potential cross-talk with other defense or susceptibility pathways

    • Varying responses to different pathogen strains

  • Genetic modification limitations:

    • Transformation efficiency varying among rice varieties

    • Potential off-target effects in genome editing approaches

    • Labor-intensive phenotyping requirements for edited lines

  • In vivo measurement challenges:

    • Difficulty measuring sugar transport without system disruption

    • Distinguishing direct SWEET14 effects from indirect responses

    • Environmental factors influencing transport dynamics

Addressing these challenges requires integrated approaches combining molecular, biochemical, genetic, and physiological techniques with advanced imaging and analytical methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.