Recombinant Oryza sativa subsp. indica Bidirectional sugar transporter SWEET15 (SWEET15)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sugar Transport

SWEET15 facilitates low-affinity, bidirectional transport of sucrose and hexoses (e.g., glucose) along concentration gradients without requiring energy input . Key functional insights include:

Table 1: Transport Activity Profile

SubstrateTransport ModeAffinityDirectionalityReference
SucroseUniportLowBidirectional (efflux/influx)
GlucoseNot detected

This contrasts with proton-coupled symporters like SUTs and MSTs, which require energy for unidirectional transport . SWEET15’s role in phloem loading and seed development has been inferred from homologs:

  • Phloem Loading: OsSWEET11 (a homolog in rice) mediates sucrose efflux from parenchyma cells to apoplasts, enabling phloem loading .

  • Seed Development: In soybean, GmSWEET15 knockout reduces embryo sucrose levels by 40–50%, causing seed abortion .

Agricultural Relevance

SWEET15 is implicated in:

  • Pathogen Susceptibility: Certain SWEET transporters are hijacked by pathogens (e.g., Xanthomonas oryzae) to access host sugars .

  • Abiotic Stress Response: SWEETs modulate sugar redistribution during drought and salinity stress .

Biotechnological Applications

  • Crop Breeding: Engineering SWEET15 expression could enhance sucrose allocation to seeds, improving yield in cereals .

  • Protein Production: Recombinant SWEET15 serves as a tool for studying sugar transport kinetics in heterologous systems (e.g., Xenopus oocytes) .

Table 2: SWEET15 vs. Proton-Coupled Transporters

FeatureSWEET15SUTs/MSTs
Energy RequirementNone (passive)Proton gradient-dependent
DirectionalityBidirectionalUnidirectional
AffinityLowHigh
SubstratesSucrose, glucose, fructoseSpecific to sucrose or hexoses

Challenges and Future Directions

  • Functional Redundancy: SWEET15 often overlaps with other SWEET homologs, complicating knockout studies .

  • Structural Insights: Crystallization of SWEET15 could elucidate substrate-binding domains for targeted engineering .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this requirement in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Should you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
SWEET15; OsI_07385; Bidirectional sugar transporter SWEET15; OsSWEET15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
SWEET15
Target Protein Sequence
MAFMSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIA LVTLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV IWFLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKKPLVASSSSAAVAAGLETKLPE HVKEVQAVAKGAVAAAPEGRISCGAEVHPIDDVMPSEVVEVKVDDEETNRTDEMAGDGDH AMVRTEQIIKPDMAIVVEV
Uniprot No.

Target Background

Function
SWEET15 mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does SWEET15 function in rice seed development?

SWEET15 plays a critical role in seed filling by facilitating sucrose transport during caryopsis (rice grain) development. Research indicates that SWEET15 mRNA levels are among the highest of SWEET family genes in rice caryopses . The protein localizes to four key sites during seed development:

  • The nucellus proper at early developmental stages

  • The aleurone tissue

  • The vascular trace

  • The nucellar epidermis

This specific localization pattern enables SWEET15 to facilitate sugar movement at critical interfaces during seed development. Functional studies have confirmed that SWEET15 operates as a sucrose transporter when co-expressed with a sucrose sensor in HEK293T cells . The importance of SWEET15 becomes particularly evident in ossweet11 mutants, where SWEET15 expression increases approximately twofold compared to wild-type, suggesting a compensatory mechanism to maintain adequate sugar transport during seed development .

How should recombinant SWEET15 be stored and handled for optimal stability?

For optimal stability and functionality of recombinant SWEET15 protein, the following storage and handling protocols are recommended:

  • Long-term storage: Store at -20°C or -80°C for extended storage periods .

  • Working aliquots: Can be stored at 4°C for up to one week .

  • Storage buffer: Typically provided in Tris/PBS-based buffer with 6% Trehalose (pH 8.0) or Tris-based buffer with 50% glycerol .

  • Reconstitution of lyophilized protein: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is recommended for long-term storage .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided . It is advisable to prepare multiple small working aliquots to minimize freeze-thaw cycles.

  • Pre-use preparation: Briefly centrifuge vials containing lyophilized protein prior to opening to bring contents to the bottom .

These storage and handling conditions are designed to maintain protein stability and functionality for research applications. Improper storage can lead to protein degradation and loss of functional activity.

What expression systems are used for producing recombinant SWEET15?

Recombinant SWEET15 protein is primarily produced using E. coli expression systems . The typical expression construct includes:

  • The full-length SWEET15 coding sequence (amino acids 1-319)

  • An N-terminal His tag to facilitate purification and detection

  • Appropriate regulatory elements for expression in E. coli

For example, recombinant SWEET15 from Oryza sativa subsp. indica (UniProt ID: A2X5B4) is expressed in E. coli with an N-terminal His tag . Similarly, SWEET15 from Oryza sativa subsp. japonica (UniProt ID: Q6K602) is also expressed in E. coli with an N-terminal His tag .

How do SWEET15 and SWEET11 interact functionally in seed filling?

The interaction between SWEET15 and SWEET11 represents a sophisticated example of functional redundancy and cooperation in sugar transport during seed development. Research findings demonstrate:

  • Complementary expression patterns: Both SWEET11 and SWEET15 show high mRNA expression levels in developing rice caryopses and localize to key tissues involved in seed filling .

  • Functional redundancy: Single ossweet11 mutants display only partially reduced seed filling, suggesting compensation by other transporters .

  • Compensatory upregulation: SWEET15 mRNA levels increase approximately twofold in ossweet11 mutant seeds compared to wild-type, indicating a compensatory regulatory mechanism .

  • Synergistic effects in double mutants: The ossweet11;15 double mutants exhibit dramatically more severe phenotypes than either single mutant, with significantly impaired seed filling .

  • Environmental influence: The severity of phenotypes in both single and double mutants varies under different greenhouse conditions, suggesting environmental factors influence the relative contributions of these transporters .

This functional relationship suggests that while SWEET11 may be the primary sugar transporter during seed filling, SWEET15 provides critical backup capacity that becomes essential when SWEET11 function is compromised. The severe phenotype of double mutants underscores that these two transporters together form the primary sucrose transport system for rice seed development.

What are effective experimental approaches for studying SWEET15 function?

Several sophisticated experimental approaches have proven effective for investigating SWEET15 function:

When designing these experiments, researchers should consider developmental timing, tissue specificity, and potential functional redundancy with other SWEET family members.

How can researchers design effective mutagenesis strategies for SWEET15 functional studies?

Designing effective mutagenesis strategies for SWEET15 functional studies requires careful consideration of several factors:

  • Target site selection: For CRISPR-Cas9 approaches, guide RNAs should target conserved or functionally critical regions. Previous successful targeting of SWEET11 used a guide RNA targeting the start codon region (5'-TCACCAGTAGCAATGGCAGG-3') , suggesting a similar approach may work for SWEET15.

  • Mutation type considerations:

    • Complete knockouts are valuable for determining essential functions

    • Missense mutations in specific domains can provide insight into structure-function relationships

    • Promoter modifications can help study expression regulation

  • Redundancy planning: Due to functional overlap with SWEET11, single SWEET15 mutants may show subtle phenotypes. Plan for generating both single and double mutants (e.g., ossweet11;15) to fully characterize function .

  • Validation strategy: Include comprehensive validation methods:

    • Genomic sequencing to confirm mutations

    • RT-PCR to verify transcript disruption

    • Western blotting (if antibodies available) to confirm protein absence

    • Phenotypic analysis focusing on seed development metrics

  • Complementation controls: Design complementation experiments using the wild-type SWEET15 gene to confirm phenotypes result from the targeted mutation rather than off-target effects.

  • Tissue-specific considerations: Since SWEET15 shows specific expression patterns in seed tissues, phenotypic analyses should focus on these tissues, including detailed examination of the nucellus, aleurone, and vascular tissues during seed development .

This multifaceted approach ensures that mutagenesis strategies provide meaningful insights into SWEET15 function while accounting for potential compensatory mechanisms and tissue-specific roles.

What methods can detect changes in SWEET15 expression during development or stress?

Multiple complementary approaches can effectively monitor SWEET15 expression changes:

  • Quantitative RT-PCR: This technique has successfully measured SWEET15 mRNA levels in different tissues and in mutant backgrounds, revealing a twofold increase in ossweet11 mutants . Experimental design should include:

    • Gene-specific primers spanning exon junctions

    • Multiple reference genes for normalization

    • Sampling across developmental stages

    • Biological and technical replicates

  • Translational reporter fusions: OsSWEET15 translational GUS fusions have been used to visualize tissue-specific expression patterns during seed development . This approach provides spatial information about expression that complements quantitative data from RT-PCR.

  • Protein detection methods: While not explicitly mentioned in the search results for SWEET15, immunodetection methods using:

    • Antibodies against SWEET15 directly

    • Anti-His antibodies for recombinant tagged versions

    • Western blotting for quantification

    • Immunolocalization for tissue-specific detection

  • RNA-seq analysis: For genome-wide expression profiling to identify co-regulated genes and regulatory networks involving SWEET15.

  • Promoter-reporter constructs: To study transcriptional regulation under different conditions, the SWEET15 promoter can be fused to reporter genes and analyzed in transgenic plants.

For stress-related studies, these methods should be applied across multiple timepoints following stress application, with appropriate controls. Combining transcript-level analysis with protein detection provides the most comprehensive understanding of expression dynamics.

How does SWEET15 compare structurally and functionally between rice subspecies?

A comparison of SWEET15 between rice subspecies reveals important similarities and subtle differences:

FeatureOryza sativa subsp. indica SWEET15Oryza sativa subsp. japonica SWEET15
UniProt IDA2X5B4 Q6K602
Protein length319 amino acids 319 amino acids
Expression systemE. coli E. coli
TagN-terminal His tag N-terminal His tag
FunctionBidirectional sugar transporter Bidirectional sugar transporter

While the search results don't provide a direct sequence comparison or functional differences between the subspecies variants, the conservation of protein length and function suggests SWEET15 plays similar roles in both subspecies. Both proteins are available as recombinant products expressed in E. coli with N-terminal His tags .

How does SWEET15 compare to other SWEET family members in rice?

SWEET15 exhibits several distinguishing characteristics compared to other SWEET family transporters in rice:

  • Expression profile: Along with SWEET11, SWEET15 shows the highest mRNA levels in rice caryopses among SWEET family members , indicating their specialized importance in seed development.

  • Clade classification: SWEET15 belongs to clade 3 of the SWEET family , which typically includes sucrose transporters. This is consistent with its confirmed sucrose transport activity.

  • Functional relationship with SWEET11:

    • SWEET15 shows functional redundancy with SWEET11

    • SWEET15 expression increases in ossweet11 mutants, suggesting compensatory regulation

    • Double mutants (ossweet11;15) show dramatically more severe phenotypes than single mutants

  • Structural properties: Like other SWEET family members, SWEET15 is a transmembrane protein, but with specific sequence characteristics that distinguish it from other family members.

  • Tissue localization: SWEET15 localizes to specific tissues during seed development, including the nucellus, aleurone, vascular trace, and nucellar epidermis . This localization pattern may differ from other SWEET transporters.

While SWEET15 shares the basic bidirectional sugar transport function with other SWEET family members, its specific expression pattern, substrate preferences, and developmental roles make it uniquely important for rice seed development.

What distinguishes SWEET15 from SWEET1b in rice?

Based on the available information, several key differences distinguish SWEET15 from SWEET1b:

FeatureSWEET15SWEET1b
Protein length319 amino acids 261 amino acids
UniProt IDA2X5B4 (indica) B8AYH1
Amino acid sequenceBegins with MAFMSMERSTW... Begins with MEDLAKFLFG...
Clade classificationClade 3 (typically sucrose transporters) Not specified in search results
Confirmed functionSucrose transporter Not specified in search results
Expression siteHigh expression in developing caryopses Not specified in search results
Developmental roleCritical for seed filling Not specified in search results

The most notable differences include:

  • The shorter protein length of SWEET1b (261 aa) compared to SWEET15 (319 aa)

  • Distinct amino acid sequences suggesting different structural properties

  • The confirmed role of SWEET15 in seed filling, while SWEET1b's function is not detailed in the search results

These differences suggest that despite belonging to the same protein family, SWEET15 and SWEET1b likely have distinct functions and expression patterns in rice, potentially transporting different sugar substrates or operating in different tissues or developmental contexts.

What are common challenges when working with recombinant SWEET15 and how can they be addressed?

Working with recombinant SWEET15 presents several challenges typical of membrane proteins, with specific solutions:

ChallengeCauseSolution
Protein instabilityMembrane protein nature- Store at -20°C/-80°C
- Avoid repeated freeze-thaw cycles
- Prepare small working aliquots
- Add glycerol (5-50%) for long-term storage
Poor solubilityHydrophobic transmembrane domains- Use recommended buffers (Tris/PBS with 6% trehalose or 50% glycerol)
- Consider detergents for membrane protein solubilization
- Optimize buffer conditions (pH, salt concentration)
Low expression yieldToxicity to host cells- Optimize induction conditions
- Consider alternative expression systems
- Use specialized E. coli strains for membrane proteins
Improper foldingE. coli limitations for membrane proteins- Lower induction temperature
- Consider eukaryotic expression systems
- Use specialized chaperones
Functional reconstitution difficultiesNeed for lipid environment- Reconstitute in proteoliposomes
- Optimize lipid composition
- Consider nanodiscs or other membrane mimetics
Transport activity verificationComplex assay requirements- Use established sucrose sensor co-expression in HEK293T cells
- Develop radioisotope-based uptake assays
- Consider fluorescent substrate analogs

Researchers should carefully follow recommended storage and handling conditions while being prepared to optimize protocols for their specific experimental needs. Starting with small-scale pilot experiments to identify and address potential issues early in the research process is highly recommended.

How can researchers verify the functional integrity of recombinant SWEET15?

Verifying the functional integrity of recombinant SWEET15 requires multiple complementary approaches:

  • Heterologous expression transport assays:

    • Co-expression with a sucrose sensor in HEK293T cells has successfully confirmed SWEET15 function as a sucrose transporter

    • This approach allows direct measurement of transport activity in a cellular context

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure elements

    • Size-exclusion chromatography to confirm proper oligomeric state

    • Thermal stability assays to assess protein folding quality

  • Substrate binding analysis:

    • Isothermal titration calorimetry (ITC) to measure substrate binding affinities

    • Microscale thermophoresis (MST) as an alternative binding measurement

  • Reconstitution-based transport assays:

    • Reconstitution into proteoliposomes for direct transport measurements

    • Fluorescent or radioisotope-labeled substrates to track movement

    • Controls with known transport inhibitors to confirm specificity

  • Complementation studies:

    • Introduction of recombinant SWEET15 into ossweet15 mutants to verify functional complementation

    • Quantitative assessment of seed-filling restoration

  • Protein-protein interaction analysis:

    • Pull-down assays to verify interactions with known partners

    • Crosslinking studies to capture transient interactions

When conducting these verifications, researchers should include appropriate positive and negative controls, and consider that functional integrity may depend on proper membrane insertion or reconstitution for this transmembrane protein.

What factors should be considered when designing transport assays for SWEET15?

Designing effective transport assays for SWEET15 requires careful consideration of multiple factors:

  • Selection of appropriate expression system:

    • HEK293T cells have been successfully used with sucrose sensors to measure SWEET15 transport activity

    • Consider expression system compatibility with the transport assay methodology

  • Substrate considerations:

    • Primary substrate: Sucrose (confirmed for SWEET15)

    • Concentration range: Include physiologically relevant concentrations

    • Labeled substrates: Consider radioactive (³H-sucrose) or fluorescent analogs

    • Control substrates: Include non-transported sugars as negative controls

  • Assay conditions optimization:

    • Temperature: Typically 25-30°C for plant proteins

    • pH: Test range to determine optimal transport conditions

    • Buffer composition: Compatible with both protein stability and detection method

    • Time course: Establish linear range of transport activity

  • Transport directionality:

    • As a bidirectional transporter, assess both uptake and efflux capabilities

    • Design assays that can distinguish between these modes

  • Controls and validations:

    • Non-functional mutant versions as negative controls

    • Known sugar transporters with distinct specificity as comparisons

    • Empty vector or untransformed cells as baseline controls

    • Transport inhibitors to confirm specificity

  • Detection methodology:

    • Direct measurement using labeled substrates

    • Indirect measurement using co-expressed sensors

    • Real-time vs. endpoint measurements

  • Data analysis approach:

    • Kinetic parameters determination (Km, Vmax)

    • Statistical analysis plan for replicates

    • Normalization strategy for protein expression levels

By systematically addressing these factors, researchers can develop robust assays that accurately characterize the transport properties of SWEET15, enabling meaningful comparisons with other transporters and between experimental conditions.

What are promising approaches for studying the regulatory network controlling SWEET15 expression?

Several sophisticated approaches can elucidate the regulatory network controlling SWEET15 expression:

  • Promoter analysis and manipulation:

    • Deletion and mutation analysis of the SWEET15 promoter to identify key regulatory elements

    • Development of reporter constructs with progressive promoter truncations

    • Site-directed mutagenesis of potential transcription factor binding sites

    • Chromatin immunoprecipitation (ChIP) to identify proteins binding to the SWEET15 promoter in vivo

  • Transcription factor identification:

    • Yeast one-hybrid screens to identify proteins binding to SWEET15 regulatory regions

    • Bioinformatic analysis to predict transcription factor binding sites

    • Co-expression analysis to identify transcription factors whose expression patterns correlate with SWEET15

    • Validation through overexpression and knockout studies of candidate regulators

  • Epigenetic regulation analysis:

    • Bisulfite sequencing to analyze DNA methylation patterns

    • ChIP-seq for histone modifications at the SWEET15 locus

    • Analysis of chromatin accessibility using ATAC-seq or DNase-seq

  • Hormone and sugar signaling:

    • Expression analysis of SWEET15 under various hormone treatments

    • Sugar sensitivity experiments to determine feedback regulation

    • Genetic analysis using hormone and sugar signaling mutants

  • Systems biology approaches:

    • Network analysis integrating transcriptomics, proteomics, and metabolomics data

    • Mathematical modeling of regulatory networks

    • Comparison of regulatory mechanisms across different SWEET family members

The compensatory upregulation of SWEET15 observed in ossweet11 mutants provides a valuable starting point, suggesting the existence of sensing mechanisms that detect reduced sugar transport capacity and adjust SWEET15 expression accordingly.

How might SWEET15 research contribute to crop improvement strategies?

SWEET15 research offers several promising avenues for crop improvement strategies:

  • Yield enhancement approaches:

    • Targeted modulation of SWEET15 expression to optimize seed filling

    • Investigation of SWEET15 variants with enhanced transport efficiency

    • Development of crops with optimized SWEET15 and SWEET11 expression patterns for improved seed development

    • Engineering feedback regulation to maintain optimal sugar transport during stress conditions

  • Stress resilience strategies:

    • Analysis of SWEET15 expression and function under drought, heat, and other stresses

    • Identification of stress-tolerant SWEET15 variants from diverse germplasm

    • Development of lines with stress-inducible SWEET15 expression to maintain seed filling under adverse conditions

  • Pathogen resistance engineering:

    • Several SWEET transporters are targets of pathogen effectors

    • Investigation of SWEET15 role in pathogen susceptibility

    • Engineering of SWEET15 variants resistant to pathogen manipulation while maintaining transport function

  • Nutrient content improvement:

    • Optimization of sugar transport during seed development may influence final seed composition

    • Investigation of how SWEET15 activity affects starch accumulation and quality

    • Potential to enhance nutritional value through modified sugar partitioning

  • Translational research across crops:

    • Identification and characterization of SWEET15 orthologs in other important crop species

    • Comparative functional studies to determine conservation of function

    • Application of successful SWEET15 engineering strategies from rice to other cereals

The central role of SWEET15 in seed filling, especially its functional redundancy with SWEET11 , suggests that careful manipulation of these transporters could significantly impact grain yield and quality, potentially contributing to food security goals.

What potential exists for structure-function studies of SWEET15 to enhance understanding of sugar transport mechanisms?

Structure-function studies of SWEET15 offer considerable potential for enhancing our understanding of sugar transport mechanisms:

  • Structural determination approaches:

    • X-ray crystallography of purified recombinant SWEET15

    • Cryo-electron microscopy to visualize transporter in different conformational states

    • NMR studies of specific domains or the whole protein in membrane mimetics

    • Molecular dynamics simulations based on structural models

  • Functional domain mapping:

    • Systematic mutagenesis of conserved residues

    • Creation of chimeric transporters with other SWEET family members

    • Identification of residues involved in substrate recognition vs. translocation

    • Engineering of modified substrate specificity through targeted mutations

  • Transport mechanism investigations:

    • Analysis of conformational changes during transport cycle

    • Determination of rate-limiting steps in transport

    • Investigation of energy coupling (or lack thereof) in transport process

    • Elucidation of the molecular basis of bidirectional transport

  • Substrate specificity studies:

    • Structural basis for sucrose recognition

    • Comparison with SWEET transporters having different substrate preferences

    • Engineering altered substrate specificity through rational design

    • High-throughput screening of mutant libraries for modified transport properties

  • Oligomerization and regulation:

    • Investigation of potential homo- or hetero-oligomerization

    • Structural basis for post-translational regulation

    • Identification of interaction sites with regulatory proteins

    • Effects of membrane lipid composition on structure and function

As a bidirectional sugar transporter with confirmed sucrose transport activity , SWEET15 represents an excellent model for understanding fundamental aspects of sugar movement across membranes in plants. The availability of recombinant protein and established functional assays provides a solid foundation for detailed structure-function investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.