Recombinant Oryza sativa subsp. indica Bidirectional sugar transporter SWEET2b (SWEET2B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
SWEET2B; OsI_03405; Bidirectional sugar transporter SWEET2b; OsSWEET2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
SWEET2B
Target Protein Sequence
MDSLYDISCFAAGLAGNIFALALFLSPVTTFKRILKAKSTERFDGLPYLFSLLNCLICLW YGLPWVADGRLLVATVNGIGAVFQLAYICLFIFYADSRKTRMKIIGLLVLVVCGFALVSH ASVFFFDQPLRQQFVGAVSMASLISMFASPLAVMGVVIRSESVEFMPFYLSLSTFLMSAS FALYGLLLRDFFIYFPNGLGLILGAMQLALYAYYSRKWRGQDSSAPLLLA
Uniprot No.

Target Background

Function

SWEET2B mediates both low-affinity uptake and efflux of sugar across the plasma membrane.

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET2b and what role does it play in rice plants?

SWEET2b is a member of the SWEET family of sugar transporters found in Oryza sativa (rice). It functions as a bidirectional sugar transporter primarily localized to the vacuolar membrane. This transporter plays a critical role in facilitating sugar storage in plant tissues, particularly in roots. SWEET2b belongs to clade I SWEETs, which generally prefer hexoses as substrates .

The vacuolar localization of SWEET2b is particularly significant for cellular energy and carbon storage processes. Like its Arabidopsis homolog AtSWEET2, rice SWEET2b is involved in regulating the movement of sugars between the cytoplasm and vacuole, which is essential for maintaining cellular osmotic balance and providing energy reserves during periods of growth or stress .

How are SWEET transporters structurally organized?

SWEET transporters in eukaryotes, including Oryza sativa SWEET2b, possess a distinctive heptahelical structure comprising seven transmembrane domains (7-TM). This organization features a tandem repeat of two 3-TM units separated by a single transmembrane domain that serves as a linker . The structure can be described as a 3-TM-1-TM-3-TM configuration.

This structural arrangement evolved from simpler prokaryotic homologs called SemiSWEETs, which contain only three transmembrane domains. Eukaryotic SWEETs likely evolved through an internal duplication of these ancestral 3-TM units, resulting in the more complex 7-TM structure observed today . The conserved MtN3/saliva motifs are present in each of the 3-TM units, indicating their functional importance in sugar transport.

What is the difference between SWEETs and SemiSWEETs?

The primary difference between SWEETs and SemiSWEETs lies in their structural complexity and evolutionary origin:

FeatureSWEETsSemiSWEETs
Organism distributionEukaryotes (plants, animals)Prokaryotes
Transmembrane domains7 (3-1-3 configuration)3
Functional unitComplete 7-TM protein or oligomersRequires dimerization to function
Evolutionary statusDerived formAncestral form
ExampleOryza sativa SWEET2bBradyrhizobium japonicum SemiSWEET1

SemiSWEETs are considered the ancestral form of these transporters, containing only a basic 3-TM unit, which is too small to create sugar-transporting pores individually. Therefore, SemiSWEETs must form at least dimers to create functional pores capable of transporting sugars. For example, Bradyrhizobium japonicum SemiSWEET1 can mediate sucrose transport when it oligomerizes .

What is the substrate specificity of rice SWEET2b?

Based on studies of its Arabidopsis homolog (AtSWEET2) and other SWEET family members, rice SWEET2b exhibits specificity primarily for hexoses. Crystal structure analysis of rice SWEET2b in the inside-open conformation has been used for molecular docking simulations with various sugars to understand its substrate specificity .

Research using SweetTrac biosensors has revealed that clade I SWEETs, including SWEET2, recognize various sugars and sugar analogs, but with different affinities. For example, in Arabidopsis, SWEET2 shows the highest affinity for D-glucose and lower affinity for D-fructose . This substrate preference is determined by specific interactions between the sugar molecules and key residues in the binding pocket of the transporter.

The stereochemistry of hydroxyl groups at positions C3, C4, and C6 of sugar substrates (numbered according to D-glucose) appears to be crucial for recognition by SWEET transporters . This stereochemical specificity helps explain why certain sugars are preferred substrates while others may act as competitive inhibitors.

How does oligomerization of SWEET proteins affect their function?

Oligomerization is critical for the function of SWEET transporters, including rice SWEET2b. Research has shown that a single 7-TM SWEET protein is insufficient to form a functional pore large enough for sugar transport. Instead, SWEETs must homo- or heterooligomerize to create fully functional transport units .

Evidence for this requirement comes from several experimental approaches:

This research suggests that the functional unit of SWEET transporters resembles the 12-TM structure of MFS transporters, but with the four 3-TM units arranged in a parallel orientation rather than as a single polypeptide . Thus, for rice SWEET2b, oligomerization is likely a prerequisite for its sugar transport capabilities in the vacuolar membrane.

What molecular mechanisms determine substrate specificity in SWEET transporters?

Substrate recognition and specificity in SWEET transporters, including rice SWEET2b, rely on a combination of specific and nonspecific interactions within the substrate-binding pocket. Research has identified several key mechanisms:

  • Specific hydrogen bonding: Conserved residues in the transporters form hydrogen bonds with key hydroxyl groups in the substrates. In Arabidopsis SWEET1, residues N73 and N192 have been identified as critical for substrate recognition .

  • Nonspecific hydrophobic interactions: Hydrophobic residues determine the size and shape of the binding pocket, influencing which substrates can be accommodated. These interactions explain the subtle differences in affinities between different SWEET homologs .

  • Binding pocket architecture: Molecular docking simulations using the crystal structure of rice SWEET2b have identified specific hydrophobic residues (equivalent to V69, I72, and V188 in AtSWEET1) that directly interact with sugars such as D-glucose, D-fructose, and D-mannose .

  • Stereochemical recognition: The orientation and position of hydroxyl groups in sugar molecules, particularly at positions C3, C4, and C6, are crucial for substrate recognition .

Mutagenesis studies have demonstrated that altering these key residues can shift substrate preferences. For example, mutations in the conserved V69 and I72 residues in the binding pocket of AtSWEET1 decreased affinity for D-glucose while increasing it for D-fructose, or vice versa .

How can Oryza sativa SWEET2b be recombinantly expressed for functional studies?

Recombinant expression of Oryza sativa SWEET2b for functional studies involves several critical considerations:

  • Expression systems: Heterologous expression systems such as yeast (particularly Saccharomyces cerevisiae) have been successfully used for SWEET transporters. The EBY4000 yeast strain, which lacks endogenous hexose transporters, provides an excellent background for functional characterization .

  • Protein tagging: C-terminus tagging with fluorescent proteins like GFP can help verify proper localization and expression while maintaining function. For rice SWEET2b, which naturally localizes to the vacuolar membrane, it's essential to confirm that this localization is preserved in the expression system .

  • Biosensor development: For functional studies, SWEET2b can be converted into a biosensor (similar to SweetTrac2 for Arabidopsis SWEET2) by intramolecular fusion of a conformation-sensitive fluorescent protein like circularly permutated, superfolded GFP .

  • Expression vectors: Use of constitutive promoters such as GPD (glyceraldehyde-3-phosphate dehydrogenase) in yeast can ensure stable expression. For some applications, genomic integration of the coding sequence may be preferable to plasmid-based expression .

  • Functional validation: Transport activity can be assessed through radiotracer uptake assays, growth complementation in auxotrophic strains, or fluorescence-based assays when using biosensor constructs .

The success of recombinant expression strategies often depends on optimizing codon usage for the host organism and ensuring proper membrane targeting, particularly for vacuolar membrane proteins like SWEET2b.

What are the key residues involved in substrate binding in SWEET transporters?

Research on SWEET transporters has identified several critical residues involved in substrate binding and specificity. For rice SWEET2b and related transporters, these include:

  • Conserved polar residues: Equivalent to N73 and N192 in Arabidopsis SWEET1, these residues form essential hydrogen bonds with hydroxyl groups of sugar substrates. Mutation of these residues abolishes transport activity .

  • Hydrophobic residues in the binding pocket: Based on the crystal structure of rice SWEET2b and molecular docking simulations, three key hydrophobic residues (V73, V76, and I193 in rice SWEET2b, corresponding to V69, I72, and V188 in AtSWEET1) directly interact with sugars like D-glucose, D-fructose, and D-mannose .

  • Conserved Y57 and G58: In Arabidopsis SWEET1, mutation of these conserved residues led to loss of activity. When these defective mutants were coexpressed with functional SWEET1, they inhibited glucose transport, indicating their critical role in transporter function .

  • Fourth transmembrane domain residues: While TM4 is the least conserved among the 7 transmembrane domains of SWEETs and serves primarily as a linker, it appears essential for proper orientation of the repeat units in a parallel configuration, which affects substrate binding and transport .

These key residues collectively form the substrate-binding pocket, determining both the general capability to transport sugars and the specific preferences for different sugar substrates.

What techniques are available for studying vacuolar membrane transporters like SWEET2b?

Studying vacuolar membrane transporters like rice SWEET2b presents unique challenges due to their intracellular localization. Several specialized techniques have been developed:

  • Fluorescent protein-based biosensors: The development of biosensors like SweetTrac2 enables real-time monitoring of transporter activity and substrate binding. These biosensors incorporate conformation-sensitive fluorescent proteins that respond to substrate binding with changes in fluorescence intensity .

  • Subcellular localization studies: Fluorescent protein tagging combined with confocal microscopy can confirm the proper localization of SWEET2b to the vacuolar membrane in both heterologous expression systems and plant cells .

  • Proxy approach for difficult-to-study transporters: Using plasma membrane transporters as proxies to convert intracellular membrane transporters into biosensors represents a viable method that bypasses the need to isolate organelles and reconstitute vesicles. This approach works particularly well for homologs with high sequence identity .

  • Yeast expression systems with modified membrane targeting: Since the vacuolar membrane in yeast shares similarities with plant vacuoles, heterologous expression in yeast provides a suitable system for studying SWEET2b function .

  • Split-protein complementation assays: Techniques such as split ubiquitin yeast two-hybrid and split GFP assays can be used to study protein-protein interactions and oligomerization of SWEET transporters, which is critical for understanding their functional mechanisms .

How can biosensors be used to study substrate specificity of SWEET transporters?

Biosensors have revolutionized the study of substrate specificity in SWEET transporters, including rice SWEET2b. Key applications include:

  • High-throughput substrate screening: Biosensors like SweetTrac2 enable screening of large libraries of sugars and sugar analogs to identify potential substrates and inhibitors. For example, screening a library of 182 natural and synthetic carbohydrates identified 15 chemicals capable of binding to AtSWEET1 .

  • Quantification of binding affinities: The affinity of SWEET transporters for different chemicals can be quantified using an equilibrium exchange constant (KR0/R), defined as the concentration of substrate that would saturate half of the biosensor at steady state .

  • Distinguishing substrates from inhibitors: By coexpressing plasma membrane transporters with vacuolar biosensors, researchers can determine whether chemicals that bind to the transporter are actual substrates (transported across the membrane) or merely competitive inhibitors .

  • Comparative analysis of homologs: Biosensors developed for different SWEET homologs (e.g., SweetTrac1 for AtSWEET1 and SweetTrac2 for AtSWEET2) allow direct comparison of substrate preferences and affinities between related transporters .

  • Mutagenesis studies: Biosensors facilitate the analysis of how mutations in specific residues affect substrate binding and transport, providing insights into structure-function relationships .

The application of biosensors to study rice SWEET2b would follow similar principles, leveraging the high sequence identity between rice and Arabidopsis SWEET proteins to design effective biosensor constructs.

What are the evolutionary implications of the structural relationship between SemiSWEETs and SWEETs?

The structural relationship between prokaryotic SemiSWEETs and eukaryotic SWEETs like rice SWEET2b offers significant evolutionary insights:

  • Evolutionary progression: SWEETs in eukaryotes likely evolved through internal duplication of the ancestral 3-TM unit found in prokaryotic SemiSWEETs. This evolutionary progression from simple 3-TM transporters to complex 7-TM transporters represents a fascinating example of protein evolution through domain duplication .

  • Functional conservation: Despite the structural differences, both SemiSWEETs and SWEETs function as sugar transporters, indicating functional conservation throughout evolution. For example, Bradyrhizobium japonicum SemiSWEET1, like Arabidopsis SWEET11, mediates sucrose transport .

  • Oligomerization requirement: Both prokaryotic SemiSWEETs and eukaryotic SWEETs require oligomerization to form functional transport units. This suggests that the basic functional mechanism has been preserved despite the structural evolution .

  • Convergent evolution with MFS transporters: Although SWEETs evolved independently from MFS transporters, both transporter families converged on a similar functional unit comprising four 3-TM units. While MFS transporters have these arranged in a single polypeptide, SWEETs achieve this through oligomerization .

  • Substrate specificity evolution: The evolution of SWEET transporters has led to diversification in substrate specificity, with different clades specializing in hexose or disaccharide transport. This specialization likely resulted from changes in key residues in the binding pocket during evolution .

How does the 3D structure relate to function in SWEET transporters?

The three-dimensional structure of SWEET transporters is intimately linked to their function:

  • Alternating access mechanism: Crystal structure analyses of rice SWEET2b in the inside-open conformation reveal how these transporters likely function through an alternating access mechanism, where the binding site alternately faces the cytoplasmic and extracellular/vacuolar sides of the membrane .

  • Substrate binding pocket formation: The arrangement of the transmembrane helices creates a substrate binding pocket lined with specific residues that determine substrate specificity. For rice SWEET2b, molecular docking simulations have identified how D-glucose, D-fructose, and D-mannose interact with this pocket .

  • Parallel orientation of 3-TM units: The 7-TM structure of eukaryotic SWEETs features a parallel orientation of the two 3-TM units, connected by the fourth TM domain serving as a linker. This orientation is crucial for proper transporter function .

  • Oligomeric assembly: The complete functional unit of SWEETs likely resembles the 12-TM structure of MFS transporters, achieved through oligomerization of SWEET proteins. This assembly creates a pore large enough for sugar transport .

  • Conformational changes during transport: The structure of SWEETs allows for conformational changes upon substrate binding, which is the basis for biosensor development. These conformational changes facilitate the movement of substrates across the membrane .

Understanding the structure-function relationship in rice SWEET2b can guide efforts to engineer transporters with modified specificities for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.