Recombinant Oryza sativa subsp. indica Bidirectional sugar transporter SWEET6b (SWEET6B)

Shipped with Ice Packs
In Stock

Description

Introduction to SWEET6B

Recombinant Oryza sativa subsp. indica Bidirectional Sugar Transporter SWEET6b (SWEET6B) is a specialized membrane protein involved in the energy-independent transport of sugars across cellular membranes. As a member of the SWEET (Sugars Will Eventually be Exported Transporters) family, SWEET6B facilitates bidirectional sugar transport along concentration gradients, playing critical roles in carbohydrate allocation during plant growth, development, and stress responses . This recombinant variant is engineered for experimental applications, enabling mechanistic studies of sugar transport in rice and related species.

Protein Architecture

SWEET6B belongs to the SWEET family of heptahelical transmembrane proteins, characterized by two conserved MtN3/saliva domains . Key structural attributes include:

  • Sequence: 254 amino acids (UniProt ID: A2WSD3) with a molecular weight of ~27.9 kDa .

  • Domains: Two tandem MtN3/saliva domains critical for substrate recognition and transport .

  • Transmembrane Topology: Seven transmembrane helices (TMHs) arranged in a 3-1-3 configuration, enabling oligomerization for functional pore formation .

Recombinant Production

SWEET6B is heterologously expressed in systems such as E. coli, yeast, or mammalian cells. Key production parameters include:

PropertyDetail
Host SystemE. coli, Yeast, Baculovirus, or Mammalian Cells
Purity≥85% (SDS-PAGE)
StorageLyophilized or liquid; stable at -20°C or -80°C
Expression TagsNone specified; native sequence retained

Transport Mechanism

SWEET6B operates as a low-affinity uniporter, mediating bidirectional transport of hexoses (e.g., glucose, fructose) and potentially sucrose . Unlike proton-coupled transporters, SWEETs rely solely on substrate concentration gradients .

Biological Significance

  • Sugar Allocation: Facilitates apoplastic sucrose loading in vascular tissues, critical for phloem transport .

  • Stress Responses: SWEET homologs in rice (e.g., OsSWEET11, OsSWEET14) are implicated in drought and pathogen responses, suggesting analogous roles for SWEET6B .

  • Pathogen Interaction: SWEETs are exploited by pathogens like Xanthomonas oryzae to hijack host sugar resources, highlighting SWEET6B’s potential role in plant-pathogen dynamics .

Tissue-Specific Expression

While direct data on SWEET6B expression is limited, related rice SWEETs show distinct patterns:

  • Vascular Tissues: High expression in phloem companion cells for sucrose export .

  • Roots and Shoots: Clade III SWEETs (e.g., OsSWEET11/14) are upregulated under abiotic stresses .

Transcriptional Regulation

  • OsDOF11: A transcription factor directly binding SWEET promoters, enhancing sucrose transporter (SUT) and SWEET expression for phloem loading .

  • Stress-Inducible Promoters: SWEET6B likely shares cis-elements with homologs responsive to osmotic stress and hormone signaling .

Mechanistic Studies

  • Oligomerization Analysis: SWEET6B forms homo- or heterooligomers, a prerequisite for functional pore assembly .

  • Substrate Profiling: Used in yeast or HEK293T assays to characterize sugar transport kinetics and inhibitor sensitivity .

Biotechnological Potential

  • Crop Engineering: Modulating SWEET6B expression could enhance sugar partitioning, improving yield or stress tolerance .

  • Pathogen Resistance: Targeting SWEET6B may reduce susceptibility to bacterial blight by limiting sugar efflux .

Comparative Analysis with Other SWEETs

FeatureSWEET6B (Clade III)AtSWEET1 (Clade I)OsSWEET11 (Clade III)
SubstrateHexoses, Sucrose (predicted)GlucoseSucrose
ExpressionVascular tissuesGuard cells, rootsPhloem companion cells
RegulationOsDOF11-dependent Abscisic acid-responsivePathogen-induced
RoleSucrose allocationGlucose uptakeSucrose efflux

Challenges and Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography is needed to resolve SWEET6B’s 3D conformation and substrate-binding pockets .

  • In Vivo Validation: CRISPR/Cas9 knockout studies in rice will clarify SWEET6B’s contribution to agronomic traits .

  • Protein Stability: Optimizing recombinant expression systems to improve yield and functional integrity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain optimal protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize the development of that tag.
Synonyms
SWEET6B; OsI_02768; Bidirectional sugar transporter SWEET6b; OsSWEET6b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
SWEET6B
Target Protein Sequence
MISPDAARNVVGIIGNVISFGLFLAPVPTFWRICKRKDVEEFKADPYLATLLNCMLWVFY GIPIVHPNSILVVTINGIGLVVEGTYLFIFFLYSPNKKRLRMLAVLGVELVFMLAVILGV LLGAHTHKKRSMIVGILCVFFGSIMYFSPLTIMGKVIKTKSVEYMPFFLSLVCFLNGVCW TAYALIRFDIYVTIPNSLGAIFGAIQLILYACYYRTTPKKTKAAKDVEMPSVISGPGAAA TASGGSVVSVTVER
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of SWEET6b in rice plants?

SWEET6b belongs to the SWEET family of bidirectional sugar transporters in rice that facilitate the movement of sugars across cell membranes. While specific SWEET6b functions are still being elucidated, research on related family members like SWEET11 and SWEET15 indicates crucial roles in carbohydrate partitioning within the plant. These transporters mediate essential sugar transport processes, particularly in reproductive tissues and during seed development . SWEET6b likely contributes to sugar efflux from source tissues and sugar import into sink tissues, similar to other characterized SWEET transporters in rice.

How is recombinant SWEET6b typically produced for research applications?

Recombinant SWEET6b protein is typically produced in bacterial expression systems, most commonly E. coli, similar to other SWEET family proteins. The full-length coding sequence (approximately 1-230 amino acids based on related SWEET proteins) is cloned into an expression vector with an N-terminal His-tag to facilitate purification . After expression induction, the protein is purified using affinity chromatography, with the final product delivered as a lyophilized powder with >90% purity as determined by SDS-PAGE . For optimal stability, the recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol and stored at -20°C/-80°C to avoid repeated freeze-thaw cycles .

What are the optimal storage conditions for maintaining SWEET6b protein activity?

Based on established protocols for similar SWEET family proteins, recombinant SWEET6b should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles . For working solutions, aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended as it can compromise protein structure and function . The optimal storage buffer is typically a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

What are the recommended approaches for studying SWEET6b localization in rice tissues?

To study SWEET6b cellular localization, researchers should consider multiple complementary approaches:

  • Translational promoter-reporter fusions: Create SWEET6b promoter-GFP/YFP fusions to examine tissue-specific expression patterns, similar to methods used for SWEET11 and SWEET15 localization .

  • Immunohistochemistry: Develop specific antibodies against SWEET6b or utilize the His-tag on recombinant proteins for immunodetection in fixed tissue sections.

  • In situ hybridization: Design RNA probes specific to SWEET6b transcripts to detect expression patterns in different tissues and developmental stages.

  • Subcellular fractionation: Isolate different membrane fractions followed by Western blotting to determine whether SWEET6b localizes primarily to plasma membrane, tonoplast, or other cellular compartments.

These approaches should be applied to various tissues and developmental stages, with particular attention to reproductive tissues and developing seeds based on known functions of related SWEET transporters .

How should researchers design CRISPR/Cas9 knockout experiments to study SWEET6b function?

When designing CRISPR/Cas9-mediated knockout experiments for SWEET6b functional analysis:

  • Target selection: Design guide RNAs targeting conserved regions within exons of the SWEET6b gene, preferably in early exons to ensure complete loss of function. Multiple guide RNAs should be designed to increase editing efficiency.

  • Off-target analysis: Perform thorough in silico analysis to minimize off-target effects, particularly considering the high homology between SWEET family members in rice.

  • Generation of single and multiple knockouts: Create both single SWEET6b knockouts and combinatorial knockouts with related SWEET transporters (like SWEET6a or other clade members) to address potential functional redundancy.

  • Phenotypic analysis pipeline: Systematically evaluate knockout lines for alterations in:

    • Carbohydrate distribution using biochemical assays

    • Growth parameters including plant height and biomass

    • Reproductive development and seed filling

    • Response to pathogens like Xanthomonas oryzae

  • Complementation tests: Perform genetic complementation with the wild-type SWEET6b gene to confirm that observed phenotypes are specifically due to SWEET6b disruption.

How can researchers differentiate between SWEET6b functions and those of other SWEET family members in rice?

Distinguishing SWEET6b functions from other family members requires a multi-faceted approach:

  • Phylogenetic analysis: Conduct comprehensive phylogenetic analysis of the SWEET family to determine evolutionary relationships and potential functional divergence between SWEET6b and other members.

  • Expression profiling: Perform detailed transcriptome analysis across tissues, developmental stages, and stress conditions to identify unique expression patterns of SWEET6b compared to other SWEET genes.

  • Substrate specificity assays: Use heterologous expression systems (like Xenopus oocytes or yeast) to determine the sugar transport specificity and kinetics of SWEET6b compared to other family members.

  • Protein-protein interaction studies: Identify SWEET6b-specific interaction partners using techniques like yeast two-hybrid, co-immunoprecipitation, or proximity labeling approaches.

  • Domain swap experiments: Create chimeric proteins between SWEET6b and other SWEET transporters to identify domains responsible for specific functions.

This comprehensive approach will help delineate the unique contributions of SWEET6b within the broader SWEET family functional landscape.

What physiological implications might arise from altered SWEET6b expression in transgenic rice lines?

Based on studies of related SWEET transporters, altered SWEET6b expression might lead to several physiological consequences:

Researchers should systematically evaluate these parameters in SWEET6b transgenic lines using both physiological measurements and molecular analyses.

What are the common challenges in purifying active recombinant SWEET6b protein and how can they be addressed?

Common challenges and solutions for recombinant SWEET6b purification:

ChallengePotential Solution
Low expression levelsOptimize codon usage for E. coli; test different promoters; use specialized E. coli strains for membrane protein expression
Protein insolubilityExpress as fusion with solubility tags (MBP, SUMO); optimize induction temperature (usually lower temperatures improve folding)
Improper foldingAdd molecular chaperones to expression system; use mild detergents for extraction
Protein aggregationInclude stabilizing agents like glycerol or trehalose in purification buffers
Low activity after purificationReconstitute in lipid nanodiscs or liposomes to restore native membrane environment
Protein degradationAdd protease inhibitors during purification; minimize purification time

Researchers should consider testing multiple expression constructs with different tags and expression conditions to optimize yield and activity of recombinant SWEET6b.

How should researchers interpret contradictory phenotypic data in SWEET6b studies?

When facing contradictory results in SWEET6b research:

  • Genetic background effects: Verify if differences in rice genetic backgrounds could explain phenotypic variations. Different cultivars may have distinct carbohydrate partitioning strategies or compensatory mechanisms.

  • Developmental timing: Examine if the contradictory results arise from observations at different developmental stages, as SWEET transporter functions are highly stage-dependent .

  • Environmental influences: Assess whether growth conditions (light intensity, photoperiod, temperature) differ between studies, as these significantly impact carbohydrate metabolism.

  • Expression level variances: Quantify actual SWEET6b expression levels across studies, as phenotypic effects often correlate with expression strength rather than simply presence/absence of the gene .

  • Functional redundancy: Consider whether other SWEET transporters might compensate for SWEET6b in different genetic backgrounds or conditions.

  • Experimental validation: Perform side-by-side comparisons using standardized protocols to directly address contradictions.

How does SWEET6b research contribute to understanding broader carbohydrate partitioning mechanisms in crops?

SWEET6b research provides valuable insights into fundamental aspects of crop physiology:

  • Source-sink relationships: Understanding SWEET6b function helps elucidate how plants regulate carbohydrate movement from photosynthetic tissues to reproductive and storage organs, which directly impacts yield potential.

  • Evolutionary conservation: Comparative analysis of SWEET6b with homologs in other crops can reveal conserved mechanisms of sugar transport across species, informing translational research.

  • Yield enhancement strategies: Knowledge of SWEET6b's role in carbohydrate partitioning may inform breeding strategies to optimize assimilate distribution for improved grain filling in cereals .

  • Stress adaptation: Understanding how SWEET6b expression changes under environmental stresses provides insights into how plants reallocate resources during challenging conditions.

  • Disease resistance engineering: Research on SWEET transporters' roles in pathogen susceptibility, particularly to bacteria like Xanthomonas, informs novel disease resistance strategies across multiple crops .

What methodological approaches should be used to study the role of SWEET6b in plant-pathogen interactions?

To investigate SWEET6b's potential role in plant-pathogen interactions:

  • Pathogen-responsive expression analysis: Monitor SWEET6b expression changes during infection with various pathogens, particularly bacterial pathogens like Xanthomonas oryzae pv. oryzae, using qRT-PCR and RNA-seq approaches.

  • Promoter analysis: Identify pathogen-responsive elements in the SWEET6b promoter and test their functionality using reporter gene assays.

  • Infection phenotyping: Challenge SWEET6b knockout, knockdown, and overexpression lines with relevant pathogens and quantitatively assess disease progression compared to wild-type plants .

  • Sugar concentration measurements: Monitor apoplastic and intracellular sugar concentrations during infection in wild-type versus SWEET6b-modified plants to determine if altered sugar distribution affects pathogen nutrition.

  • TAL effector analysis: Investigate whether SWEET6b is targeted by transcription activator-like (TAL) effectors from Xanthomonas or similar bacterial pathogens, using approaches like electrophoretic mobility shift assays.

  • Immunolocalization during infection: Examine changes in SWEET6b protein localization during pathogen infection to determine if pathogens manipulate not just expression but also subcellular targeting.

What emerging technologies hold promise for advancing SWEET6b functional characterization?

Several cutting-edge approaches could significantly enhance SWEET6b research:

  • CryoEM structure determination: Resolving the three-dimensional structure of SWEET6b at atomic resolution would provide unprecedented insights into its transport mechanism and substrate specificity.

  • Single-cell transcriptomics: Applying single-cell RNA-seq to rice tissues would reveal cell-type specific expression patterns of SWEET6b that may be missed in bulk tissue analysis.

  • Optogenetic control: Developing light-activated versions of SWEET6b would allow precise temporal control of sugar transport in specific tissues to dissect its physiological roles.

  • Biosensors: Creating FRET-based sugar sensors to monitor real-time changes in sugar concentrations in different cellular compartments in response to SWEET6b activity.

  • Genome editing technologies beyond knockout: Using base editing or prime editing to introduce specific amino acid changes could help identify critical residues for SWEET6b function without completely abolishing the protein.

  • Synthetic biology approaches: Reconstituting minimal sugar transport systems with defined components including SWEET6b could help understand its interactions with other transporters and regulatory proteins.

How might advanced phenotyping approaches enhance our understanding of SWEET6b function in whole plants?

Advanced phenotyping strategies for SWEET6b research:

  • High-throughput automated phenotyping: Implement automated imaging systems to continuously monitor growth parameters of SWEET6b transgenic lines under various environmental conditions.

  • Metabolic flux analysis: Apply 13C-labeling and metabolic flux analysis to track sugar movement through different pathways and tissues in plants with altered SWEET6b expression.

  • Hyperspectral imaging: Use non-destructive hyperspectral imaging to detect subtle changes in plant physiology and stress responses related to altered carbohydrate distribution.

  • Field-based phenomics: Deploy field-based phenotyping platforms to assess SWEET6b-modified plants under realistic agricultural conditions to bridge the lab-field gap.

  • Integrated multi-omics: Combine transcriptomics, proteomics, and metabolomics data from the same experimental system to build comprehensive models of how SWEET6b impacts whole-plant physiology.

  • Non-invasive sugar transport imaging: Develop methods to visualize sugar movement in living plants, possibly using fluorescently labeled sugar analogs in combination with confocal microscopy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.