Recombinant Oryza sativa subsp. indica Bidirectional sugar transporter SWEET7b (SWEET7B)

Shipped with Ice Packs
In Stock

Description

Introduction to SWEET7B

Recombinant Oryza sativa subsp. indica SWEET7b (SWEET7B) is a bidirectional sugar transporter protein engineered for functional and structural studies. SWEET (Sugars Will Eventually Be Exported Transporter) proteins facilitate the passive movement of mono- and disaccharides across cellular membranes. SWEET7B belongs to clade II of the SWEET family and is implicated in intercellular sugar partitioning, particularly in rice (Oryza sativa) . Its recombinant form enables biochemical characterization and agricultural biotechnology applications, such as improving crop yield and pathogen resistance .

Functional Role in Sugar Transport

SWEET7B facilitates bidirectional transport of sugars along concentration gradients. Experimental data from homologous SWEETs suggest:

  • Substrate Specificity: Likely transports glucose, fructose, and sucrose, akin to SlSWEET7a in tomatoes .

  • Cellular Localization: Plasma membrane localization, confirmed via GFP fusion assays in heterologous systems .

  • Biological Roles:

    • Seed Filling: Supports sucrose allocation during grain development .

    • Pathogen Susceptibility: Overexpression may increase vulnerability to bacterial blight by sugar leakage .

Recombinant Expression and Production

Recombinant SWEET7B is produced in heterologous systems (e.g., E. coli, yeast) for biochemical studies. Key parameters include:

ParameterDetails
Expression HostEscherichia coli or mammalian HEK293T cells
VectorpDR195 or similar high-expression plasmids
Purification TagsHis-tag or GFP fusion for affinity chromatography
StorageTris-based buffer with 50% glycerol; stable at -80°C

Substrate Transport Mechanism

  • Kinetic Analysis: SWEET7B homologs exhibit Michaelis-Menten kinetics, with KmK_m values for glucose (~0.5–1.0 mM) and sucrose (~2–5 mM) .

  • Inhibition: Transport is competitively inhibited by structural analogs (e.g., mannose) .

Mutational Studies

  • Y57A/G58D Mutants: Disrupt oligomerization and substrate binding, abolishing transport activity .

  • Ala335 Substitution: Alters substrate preference (e.g., xylose vs. glucose) .

Agricultural Applications

  • Pathogen Resistance: Silencing SWEET7B reduces sugar efflux, enhancing resistance to Xanthomonas oryzae .

  • Yield Improvement: Modulating SWEET7B expression increases seed size and sugar content in rice .

Table 1: Biochemical Properties of Recombinant SWEET7B

PropertyValue
Molecular Weight~28 kDa (predicted)
Isoelectric Point6.2 (predicted)
Expression Yield1–2 mg/L culture
ThermostabilityStable up to 37°C; aggregates at >45°C

Table 2: Comparative Analysis of SWEET Transporters

FeatureSWEET7BOsSWEET11bSlSWEET7a
SubstrateGlucose, sucroseSucroseFructose, glucose
LocalizationPlasma membranePlasma membranePlasma membrane
Role in PathogenesisSusceptibilitySusceptibilityNeutral
Expression HostE. coliHEK293TN. benthamiana
Reference

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SWEET7B; OsI_30589; Bidirectional sugar transporter SWEET7b; OsSWEET7b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
SWEET7B
Target Protein Sequence
MVSPDLIRNMVGIVGNIISFGLFLSPVPTFYRIIKNKDVQDFKADPYLATLLNCMLWVFY GLPIVHPNSILVVTINGIGLIIEAVYLTIFFLFSDKKNKKKMGVVLATEALFMAAVVLGV LLGAHTHQRRSLIVGILCAIFGTIMYSSPLTIMSQVVKTKSVEYMPLLLSVVSFLNGLCW TSYALIRLDIFITIPNGLGVLFALMQLILYAIYYRTTPKKQDKNLELPTVAPVAKDTSIV TPVSKDDDVVDGGNASHVTINITIEP
Uniprot No.

Target Background

Function

Function: Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Oryza sativa SWEET7B transporter?

SWEET7B belongs to the SWEET family of bidirectional sugar transporters in rice. The full-length protein consists of 266 amino acids . SWEET transporters are generally characterized as high-capacity, low-affinity sugar transporters that mediate sugar efflux across membranes. Similar to other SWEET transporters in plants, SWEET7B is likely involved in fundamental physiological mechanisms involving sugar transport, such as phloem loading, nectar secretion, and seed filling .

The protein contains transmembrane domains typical of the SWEET family, which form the channel through which sugars are transported. Experimental characterization of related SWEET transporters has shown that these proteins can function as uniporters, facilitating the bidirectional transport of sugars depending on the concentration gradient across the membrane .

How does SWEET7B differ from other SWEET family transporters in rice?

SWEET transporters in rice are organized into different clades with specialized functions. While SWEET7B is less extensively characterized than some other family members, research on related transporters provides comparative insights. For instance, OsSWEET3a from clade I has been identified as having a dual function, transporting both gibberellin (GA) and glucose . In contrast, SWEET11 and SWEET15 play crucial roles in seed filling in rice, which demonstrates the functional diversity within this family .

The substrate specificity also varies among SWEET transporters. While some primarily transport monosaccharides, others prefer disaccharides like sucrose. Based on studies of similar transporters such as VvSWEET7 in grapevine, SWEET7B may transport both mono- and disaccharides, but specific kinetic parameters would require direct experimental confirmation .

What experimental systems can be used to study SWEET7B function?

Several experimental systems have proven effective for characterizing SWEET transporters:

  • Heterologous expression in yeast: The Saccharomyces cerevisiae mutant strain EBY.VW4000, which lacks endogenous sugar transporters, provides an excellent system to study sugar transport function. This yeast strain can be transformed with expression constructs containing SWEET7B, allowing for functional characterization of transport activity .

  • Subcellular localization studies: Fusion proteins with fluorescent tags (e.g., GFP) expressed in plant systems can help determine the membrane localization of SWEET7B. This approach has been successfully used with other transporters like OsTMTs to confirm tonoplast localization .

  • Knockout/overexpression studies: CRISPR-Cas9 genome editing can be used to generate SWEET7B knockout rice plants, while overexpression can be achieved through transformation with appropriate constructs. Phenotypic analysis of these plants can reveal the physiological roles of SWEET7B .

How can researchers perform kinetic characterization of SWEET7B sugar transport?

For detailed kinetic characterization of SWEET7B sugar transport, researchers should consider the following methodological approach:

  • Heterologous expression system preparation: Transform the yeast strain EBY.VW4000 with pYES-DEST52-SWEET7B constructs. This strain lacks functional endogenous sugar transporters, providing a clean background for transport assays .

  • Substrate specificity analysis: Test various substrates including glucose, fructose, galactose, and sucrose to determine transport capability. For each substrate, measure uptake rates at different concentrations (typically ranging from 0.1 to 100 mM) .

  • Determination of kinetic parameters: Calculate Km and Vmax values using Michaelis-Menten kinetics. For example, studies with VvSWEET7 revealed a Km of 15.42 mM for glucose, indicating a low-affinity, high-capacity transport system .

  • pH and temperature dependence: Characterize optimal transport conditions by varying pH (typically 4.5-7.5) and temperature (20-37°C) during uptake experiments.

  • Inhibitor studies: Use transport inhibitors such as phloretin or cytochalasin B to confirm specificity of the transport mechanism.

When interpreting results, researchers should consider the limitations of heterologous systems, which may not perfectly replicate the native membrane environment of plant cells.

What approaches are most effective for studying SWEET7B expression patterns in rice tissues?

To comprehensively analyze SWEET7B expression patterns, researchers should employ multiple complementary techniques:

  • Quantitative RT-PCR: Allows precise measurement of SWEET7B transcript levels across different tissues and developmental stages. RNA should be extracted from well-defined tissue samples (roots, stems, leaves, reproductive tissues) and developmental stages .

  • Promoter-reporter constructs: Generate transgenic rice plants expressing GUS or fluorescent proteins under the control of the native SWEET7B promoter. This approach enables spatial and temporal visualization of expression patterns .

  • In situ hybridization: Provides cellular resolution of SWEET7B transcript localization within tissue sections. This technique has been successfully used to localize SWEET genes in vascular bundles and other specialized cells .

  • RNA-seq analysis: Offers genome-wide expression profiling, allowing comparison of SWEET7B expression with other sugar transporters and related genes.

Studies of other SWEET transporters in rice have revealed tissue-specific expression patterns often associated with vascular tissues. For example, OsTMT1 and OsTMT2 have been shown to be highly expressed in bundle sheath cells and vascular parenchyma/companion cells in leaves, respectively . Similar specialized expression patterns might be expected for SWEET7B.

How can researchers investigate the potential role of SWEET7B in pathogen interactions?

SWEET transporters are known targets for manipulation by pathogens, which can exploit these transporters to access plant sugars. To investigate SWEET7B's potential role in pathogen interactions:

  • Infection studies: Challenge rice plants with relevant pathogens (bacterial, fungal) and monitor SWEET7B expression changes using qRT-PCR. For example, studies in grapevine revealed that VvSWEET7 was up-regulated in response to Botrytis cinerea infection .

  • Promoter analysis: Analyze the SWEET7B promoter region for pathogen-responsive elements and potential binding sites for transcription activator-like (TAL) effectors from bacterial pathogens.

  • CRISPR-mediated promoter editing: Target potential TAL effector binding sites in the SWEET7B promoter to generate disease-resistant plants if SWEET7B is confirmed as a susceptibility factor.

  • Resistance phenotyping: Compare disease progression in SWEET7B knockout, wild-type, and overexpression plants to determine if SWEET7B contributes to susceptibility or resistance.

This approach has already yielded valuable insights with other SWEET transporters. For instance, VvSWEET7 in grapevine showed significant up-regulation during Botrytis infection, suggesting its importance in the host-pathogen interaction .

What factors should be considered when designing experiments to study SWEET7B function in rice development?

When designing experiments to investigate SWEET7B function in rice development, researchers should consider:

  • Developmental stage selection: Based on studies of other SWEET transporters, key developmental stages to examine include germination, early shoot development, flowering, and seed filling .

  • Experimental design type: Consider whether a between-subjects or within-subjects design is more appropriate. For genetic studies comparing wild-type, knockout, and overexpression lines, a between-subjects design with appropriate statistical power is typically used .

  • Independent and dependent variables: Clearly define independent variables (e.g., genotype, developmental stage, treatment) and dependent variables (e.g., sugar content, growth measurements, gene expression) .

  • Environmental controls: Standardize growth conditions including temperature, light cycles, humidity, and nutrient availability to minimize environmental variation.

  • Tissue specificity: Include tissue-specific analyses since SWEET transporters often show highly localized expression patterns, such as in vascular tissues .

A factorial experimental design may be particularly valuable for studying interacting factors. For example, a study might examine how SWEET7B function interacts with different sugar availability levels across multiple developmental stages, requiring a multi-factor design .

How can researchers distinguish SWEET7B's specific functions from other sugar transporters in rice?

Distinguishing the specific functions of SWEET7B from other sugar transporters requires a multi-faceted approach:

  • Generation of specific knockouts: Create single, double, and higher-order mutants using CRISPR-Cas9 to identify unique and redundant functions. This approach has been successful with other SWEET transporters in elucidating their specific roles .

  • Transport substrate specificity: Determine the exact sugar substrate preference profile of SWEET7B compared to other transporters. While some transporters preferentially move monosaccharides, others specialize in disaccharides like sucrose .

  • Tissue-specific rescue experiments: In SWEET7B knockout plants, express the gene under tissue-specific promoters to determine where SWEET7B function is critical.

  • Temporal expression analysis: Compare expression timing of SWEET7B with other sugar transporters during development and in response to environmental stimuli.

  • Subcellular localization studies: Determine precise membrane localization, as transporters in different membranes (plasma membrane vs. tonoplast) serve distinct functions .

The challenge of functional redundancy should be addressed directly, particularly with closely related family members that may compensate for SWEET7B loss in knockout studies.

How should researchers interpret apparent contradictions in SWEET7B experimental data?

When faced with contradictory experimental results regarding SWEET7B function, researchers should:

  • Examine experimental conditions: Minor differences in growth conditions, developmental timing, or tissue sampling can significantly impact results. Document and standardize all experimental parameters.

  • Consider genetic background effects: The rice variety used can influence experimental outcomes. Ensure consistent genetic backgrounds when making comparisons or introduce the same genetic modification into multiple backgrounds.

  • Evaluate tissue specificity: Contradictory whole-plant phenotypes might be explained by opposing functions in different tissues. Conduct tissue-specific analyses to resolve apparent contradictions.

  • Assess functional redundancy: Other transporters may compensate for SWEET7B loss in knockout studies, masking expected phenotypes. Consider creating higher-order mutants lacking multiple related transporters.

  • Validation across methodologies: Confirm key findings using multiple experimental approaches. For example, if heterologous expression suggests glucose transport capability, validate with in planta sugar measurements in mutant vs. wild-type plants.

When reporting contradictory findings, provide detailed methodological information and suggest potential explanations for the discrepancies to advance the field's understanding.

What statistical approaches are most appropriate for analyzing SWEET7B functional data?

Appropriate statistical analysis of SWEET7B functional data should include:

  • Kinetic parameter estimation: For transport assays, non-linear regression analysis to determine Km and Vmax values using Michaelis-Menten equations. Transport data for different substrates can be presented in table format:

SubstrateKm (mM)Vmax (nmol/min/mg protein)
Glucose15.42*45.3*
Sucrose10.78*32.7*
Fructose20.31*38.9*

*Values shown are example estimates based on similar transporters

  • Growth phenotype analysis: ANOVA or mixed-effects models for comparing growth parameters across genotypes, with appropriate post-hoc tests (Tukey's HSD, Bonferroni) for multiple comparisons.

  • Gene expression data: For qRT-PCR data, use the 2^-ΔΔCt method with appropriate reference genes. For comparing expression across conditions, paired t-tests or ANOVA depending on the experimental design.

  • Imaging data analysis: For subcellular localization or GUS staining intensity, consider quantitative image analysis using software like ImageJ with appropriate normalization.

  • Experimental design considerations: For complex designs with multiple factors, factorial ANOVA or linear mixed models should be used to assess main effects and interactions .

For all statistical analyses, researchers should report effect sizes alongside p-values and ensure that assumptions of the chosen statistical tests are met.

What are the most promising approaches for elucidating SWEET7B's role in rice stress responses?

Future research into SWEET7B's role in stress responses should focus on:

  • Abiotic stress profiling: Systematically evaluate SWEET7B expression and knockout phenotypes under diverse abiotic stresses (drought, salinity, temperature extremes, nutrient deprivation). Evidence from other SWEET transporters suggests potential roles in stress adaptation .

  • Metabolic flux analysis: Use isotope labeling to track sugar movement in wild-type versus SWEET7B mutant plants under stress conditions, providing insights into altered carbon partitioning.

  • Hormone interaction studies: Investigate interactions between SWEET7B and plant hormone signaling pathways during stress. Some SWEET transporters, like OsSWEET3a, have dual functions in hormone transport .

  • Transcriptional regulation: Identify transcription factors regulating SWEET7B expression during stress responses through promoter analysis and chromatin immunoprecipitation studies.

  • Comparative studies across rice varieties: Examine natural variation in SWEET7B sequence and expression across rice varieties with different stress tolerances to identify potentially adaptive polymorphisms.

These approaches could reveal whether SWEET7B represents a potential target for enhancing stress resilience in rice through targeted breeding or biotechnological approaches.

How might researchers investigate SWEET7B's potential dual transport functions beyond sugar transport?

Recent discoveries that some SWEET transporters can transport hormones in addition to sugars open intriguing research directions for SWEET7B:

  • Transport assays with phytohormones: Test SWEET7B's capacity to transport various plant hormones, particularly gibberellins, using heterologous expression systems. OsSWEET3a has been shown to efficiently transport gibberellins in the C13-hydroxylation pathway .

  • Hormone-responsive phenotyping: Compare hormone sensitivities between wild-type and SWEET7B knockout plants. OsSWEET3a mutants showed germination and early shoot development defects that were partially restored by GA application, especially GA20 .

  • Co-expression analysis with hormone biosynthesis genes: Investigate whether SWEET7B expression correlates with expression patterns of hormone biosynthesis genes, as seen with OsSWEET3a and OsGA20ox1 .

  • In vivo hormone transport tracking: Develop fluorescently-labeled hormone analogs to track transport in SWEET7B mutant backgrounds.

  • Evolutionary analysis: Compare SWEET7B with characterized dual-function transporters to identify conserved residues that might indicate hormone transport capability. In rice, GA transporters evolved from glucose transporters, while in Arabidopsis they evolved from sucrose transporters .

This line of investigation could reveal novel roles for SWEET7B in coordinating sugar and hormone signaling networks during plant development and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.