Recombinant Oryza sativa subsp. indica CASP-like protein OsI_03581 (OsI_03581)

Shipped with Ice Packs
In Stock

Description

Functional Insights

OsI_03581 is part of the CASP-like (CASPL) protein family, which shares structural and functional homology with Arabidopsis CASPs. These proteins mediate membrane scaffold formation and lignin deposition in root endodermal cells . Key findings include:

  • Role in Membrane Scaffolding: CASPLs integrate into CASP membrane domains, suggesting shared scaffolding properties critical for Casparian strip formation .

  • Stress Response: OsI_03581 homologs (e.g., OsCASP1) are upregulated under salt stress, indicating roles in ionic homeostasis .

  • Genetic Redundancy: Functional studies in Arabidopsis reveal redundancy among CASPLs, complicating direct phenotypic analysis of single mutants .

Table 2: Comparative Analysis of CASPLs in Plants

SpeciesProteinFunctionExpression Pattern
Oryza sativaOsI_03581Membrane scaffolding, stress responseRoot stele, sclerenchyma
ArabidopsisAtCASPL4C1Growth regulation, cold toleranceRoot endodermis
Populus trichocarpaPOPTRDRAFT_553757Integral membrane scaffoldingUndetermined

Research Applications and Tools

Recombinant OsI_03581 is widely used in biochemical studies. Key resources include:

  • Antibodies: Rabbit polyclonal antibodies against OsI_03581 enable detection via ELISA and Western blot .

  • Expression Constructs: Full-length and partial recombinant proteins are available with His tags for purification .

  • Functional Assays: Studies leverage mutants (e.g., CRISPR/Cas9-generated Oscasp1-4) to explore OsI_03581’s role in lignin deposition and ion balance .

Unresolved Questions and Future Directions

  • Pathway Involvement: No specific pathways for OsI_03581 are yet defined, though related CASPs interact with peroxidases for lignin polymerization .

  • Localization Dynamics: Conflicting reports exist on OsI_03581’s subcellular localization in root tissues, necessitating further immunostaining studies .

  • Stress Adaptation: Mechanistic links between OsI_03581 and abiotic stress tolerance (e.g., salinity) remain underexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
OsI_03581; CASP-like protein 3A1; OsCASPL3A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_03581
Target Protein Sequence
MGSIGNGRNGSEVGIQIPAMGNKEVLERPAIPRWPRLGVVMVATRAVALVMAVLSMALMI SAKQRGSLKIFGIEIPLYANWSFSDSLEYLVGMSAVSAAYCLAQLLLTAHKAVKNAPVVQ SRNYAWLLFTGDQIFAYAMMSAGSAAAAVANLNRTGIRHTALPNFCKPLPRFCDLSAASI ACAFLSCIFLAASAVIDVIWLSNM
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Oryza sativa subsp. indica CASP-like protein OsI_03581 and what is its biological significance?

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_03581 (OsI_03581) is a rice protein that belongs to the CASP (Casparian strip membrane domain proteins) family. In plants, particularly rice, OsCASP1 plays a crucial role in orchestrating Casparian strip (CS) formation and regulating suberin deposition. The biological significance of this protein lies in its contribution to nutrient homeostasis and environmental adaptation in rice plants. Research has shown that OsCASP1 forms a transmembrane scaffold to recruit lignin biosynthetic enzymes for CS formation, similar to its Arabidopsis counterparts . Additionally, OsCASP1 expression is predominantly concentrated in small lateral root (SLR) tips and can be upregulated by salt stress, particularly in the steles, indicating its role in stress response mechanisms .

How does OsI_03581 compare structurally and functionally to Arabidopsis CASP proteins?

Functionally, both OsCASP1 and AtCASPs form transmembrane scaffolds for CS formation, but the appearance time and structure of CS in rice roots differ from those in Arabidopsis. OsCASP1 also appears to have a broader role in regulating suberin deposition in both the endodermis and sclerenchyma, whereas AtCASPs primarily function in endodermal CS formation .

What experimental design approaches are recommended when studying OsI_03581 function in rice plants?

When designing experiments to study OsI_03581 function, researchers should consider a systematic approach with the following key steps:

  • Define clear variables: Establish independent variables (e.g., genotype, environmental conditions) and dependent variables (e.g., CS formation, suberin deposition, salt tolerance) .

  • Formulate specific hypotheses: Based on previous findings, develop testable hypotheses about OsI_03581's role in specific processes .

  • Design appropriate treatments: Include wild-type controls, Oscasp1 mutants, and complementation lines. Consider environmental treatments such as salt stress that are known to induce OsCASP1 expression .

  • Group assignment: Use either between-subjects design (comparing different plant lines) or within-subjects design (measuring the same plants under different conditions) .

  • Measurement planning: Determine specific methods to quantify CS formation, suberin deposition, nutrient uptake, and stress responses .

A robust experimental design should include multiple biological and technical replicates, appropriate controls, and methods to minimize experimental bias. When working with mutants, it's advisable to use multiple independent mutant lines (e.g., the various Oscasp1 mutants described in the literature) to confirm that observed phenotypes are due to the loss of OsCASP1 function rather than background effects .

How should researchers approach comparative studies between OsI_03581 and other CASP proteins?

For comparative studies between OsI_03581 and other CASP proteins, researchers should:

  • Sequence alignment and phylogenetic analysis: Begin with bioinformatic approaches to understand evolutionary relationships and conserved domains.

  • Expression pattern comparison: Use techniques like GUS reporter assays to compare tissue-specific expression patterns, as demonstrated in studies comparing OsCASP1 expression to AtCASPs .

  • Functional complementation: Test whether OsI_03581 can rescue phenotypes in Arabidopsis casp mutants and vice versa to determine functional conservation.

  • Structural analysis: Compare protein localization and interaction partners using techniques like fluorescent protein tagging and co-immunoprecipitation.

  • Phenotypic comparison: Systematically compare phenotypes of mutants in different species under identical growth conditions.

When designing these experiments, researchers should control for species-specific differences in root development and environmental adaptations. The experimental design should account for the different root structures between rice and Arabidopsis, and measurements should be standardized to allow meaningful cross-species comparisons .

What methodological approaches are recommended for studying OsI_03581 expression patterns?

To study OsI_03581 expression patterns, several complementary methodologies are recommended:

  • Promoter-GUS fusion analysis: Generating transgenic plants carrying OsCASP1pro:OsCASP1-GUS constructs allows visualization of tissue-specific expression through histochemical staining. This approach has revealed that OsCASP1 is highly expressed in SLR tips and can be induced by salt stress .

  • RT-qPCR: Quantitative PCR should be performed on RNA extracted from different tissues and under various conditions to quantitatively assess expression levels. Studies have shown that OsCASP1 is highly expressed in SLRs and younger roots, moderately expressed in primary root tips, and weakly expressed in leaves .

  • In situ hybridization: This technique provides high-resolution spatial information about transcript localization in tissue sections.

  • RNA-seq: For genome-wide expression analysis, comparing wild-type and mutant plants under different conditions.

  • Western blotting: Using specific antibodies to detect protein levels in different tissues.

Each of these methods has strengths and limitations, so combining multiple approaches provides the most comprehensive picture of expression patterns. Researchers should include appropriate controls and standardize conditions across experiments for reliable comparisons .

What phenotypic changes are observed in Oscasp1 mutants and how should they be analyzed?

Oscasp1 mutants exhibit several distinct phenotypic changes that require systematic analysis:

  • Morphological phenotypes:

    • Withered leaves

    • Reduced number of tillers

    • Altered root architecture

  • Cellular and structural changes:

    • Delayed Casparian strip (CS) formation

    • Uneven lignin deposition in small lateral roots (SLRs)

    • Altered suberin deposition in both the endodermis and sclerenchyma

  • Physiological responses:

    • Ion imbalance in plant tissues

    • Reduced tolerance to salt stress

For robust analysis of these phenotypes, researchers should:

  • Compare multiple independent mutant lines (e.g., Oscasp1-1, Oscasp1-3, Oscasp1-4) to confirm consistent phenotypes .

  • Perform complementation studies using constructs like OsCASP1pro:OsCASP1 to verify that phenotypes can be rescued, confirming they result from loss of OsCASP1 function .

  • Quantify phenotypes using appropriate statistical methods rather than relying on qualitative observations. For example, measure ion content using ICP-MS, quantify lignin and suberin deposition using fluorescence intensity, and assess salt tolerance using standardized stress assays.

  • Examine phenotypes at different developmental stages to understand the temporal progression of defects.

  • Use multiple staining techniques (e.g., Basic Fuchsin for lignin, fluorescent dyes for suberin) to comprehensively analyze cell wall modifications .

How can researchers effectively examine Casparian strip formation and suberin deposition in Oscasp1 mutants?

Examining Casparian strip formation and suberin deposition in Oscasp1 mutants requires specialized techniques:

  • For Casparian strip visualization:

    • Clear tissue using ClearSee solution to enhance optical transparency

    • Perform dual staining with Basic Fuchsin (for lignin) and Calcofluor White (for cell walls)

    • Use confocal microscopy for whole-mount observation of small lateral roots

    • Examine cross-sections of primary roots for analysis of larger tissues

  • For suberin analysis:

    • Use Fluorol Yellow 088 staining to visualize suberin lamellae

    • Perform quantitative analysis of suberization patterns along the root axis

    • Compare timing and pattern of suberin deposition between wild-type and mutant plants

    • Examine both endodermis and sclerenchyma, as OsCASP1 affects suberin deposition in both tissues

  • For barrier function assessment:

    • Traditional propidium iodide (PI) penetration assays must be interpreted cautiously, as rice roots can hinder but not completely prevent PI entry into the stele, unlike in Arabidopsis

    • Consider alternative approaches such as measuring ion leakage or using other apoplastic tracers

When analyzing results, researchers should note that CS formation in rice differs from Arabidopsis in timing and structure. The first appearance of CS in rice is earlier than in Arabidopsis, and researchers should focus particularly on SLRs as they provide clearer visualization opportunities after appropriate clearing and staining .

What experimental approaches should be used to study the role of OsI_03581 in stress responses, particularly salt stress?

To investigate OsI_03581's role in stress responses, particularly salt stress, researchers should employ a multi-faceted experimental approach:

  • Gene expression analysis:

    • Quantify OsCASP1 expression under various salt concentrations and exposure times using RT-qPCR

    • Use promoter-GUS fusion plants to visualize tissue-specific expression changes during salt stress

    • Perform RNA-seq to identify co-regulated genes during stress responses

  • Physiological measurements:

    • Compare growth parameters (height, biomass, root length) of wild-type and mutant plants under salt stress

    • Measure ion content (Na+, K+, other nutrients) in different tissues using ICP-MS

    • Assess water relations parameters (relative water content, osmotic potential)

  • Cellular and molecular analyses:

    • Examine changes in CS formation and suberin deposition under salt stress

    • Measure oxidative stress markers (ROS, antioxidant enzymes)

    • Analyze changes in expression of known salt response genes

  • Genetic interaction studies:

    • Create double mutants with known salt stress response genes

    • Perform epistasis analysis to position OsCASP1 in stress response pathways

  • Recovery experiments:

    • Assess ability of plants to recover after salt stress removal

    • Compare long-term versus short-term adaptations

When designing these experiments, it's important to standardize stress conditions (intensity, duration, application method) and include appropriate controls. Analyzing multiple parameters in parallel provides a more comprehensive understanding of OsCASP1's role in stress adaptation .

What are the optimal storage and handling conditions for recombinant OsI_03581 protein?

Proper storage and handling of recombinant OsI_03581 protein is critical for maintaining its activity and stability. Based on product information, researchers should follow these guidelines:

  • Storage temperature:

    • Store at -20°C for regular use

    • For extended storage, conserve at -20°C or -80°C

  • Shelf life:

    • Liquid form: approximately 6 months at -20°C/-80°C

    • Lyophilized form: approximately 12 months at -20°C/-80°C

  • Handling precautions:

    • Avoid repeated freezing and thawing as this significantly reduces protein activity

    • Store working aliquots at 4°C for up to one week

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • Reconstitution recommendations:

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for long-term storage (50% is commonly recommended)

  • Quality control:

    • Verify protein integrity by SDS-PAGE before experimental use

    • If possible, confirm activity via appropriate functional assays

Following these guidelines will help ensure that experiments are performed with properly functioning protein, leading to more reliable and reproducible results .

What experimental approaches are recommended for studying OsI_03581 protein-protein interactions?

For investigating OsI_03581 protein-protein interactions, researchers should consider multiple complementary approaches:

  • Yeast two-hybrid (Y2H) screening:

    • Useful for initial identification of potential interaction partners

    • Use full-length OsI_03581 or specific domains as bait against rice cDNA libraries

    • Verify positive interactions through multiple selection markers

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against OsI_03581 or its tagged version to pull down protein complexes

    • Identify interacting proteins through mass spectrometry

    • Confirm specific interactions by western blotting with antibodies against suspected partners

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments are fused to potential interacting proteins

    • Fluorescence is restored when proteins interact in planta

    • Allows visualization of where in the cell interactions occur

  • Förster Resonance Energy Transfer (FRET):

    • Label OsI_03581 and potential partners with appropriate fluorophores

    • Measure energy transfer as indication of protein proximity

    • Provides dynamic information about interactions in living cells

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC):

    • For quantitative analysis of binding kinetics and affinity

    • Requires purified recombinant proteins

    • Provides thermodynamic parameters of interactions

  • Proximity-dependent biotin identification (BioID):

    • Fusion of OsI_03581 with a biotin ligase

    • Allows identification of proximal proteins in their native cellular environment

Based on research with related CASP proteins, investigators should focus on interactions with lignin biosynthetic enzymes, other CASP family proteins that might form heteromeric complexes, and signaling proteins involved in stress responses .

What are the methodological considerations for examining OsI_03581 subcellular localization?

To accurately determine OsI_03581 subcellular localization, researchers should consider these methodological approaches:

  • Fluorescent protein fusions:

    • Generate constructs with OsI_03581 fused to GFP, YFP, or other fluorescent proteins

    • Create both N- and C-terminal fusions as tag position may affect localization

    • Use appropriate promoters (native or constitutive) depending on experimental goals

    • Perform transient expression in protoplasts for initial studies and generate stable transgenic plants for in vivo analysis

  • Immunolocalization:

    • Develop specific antibodies against OsI_03581

    • Perform immunofluorescence on fixed cells and tissues

    • Use multiple fixation protocols to preserve membrane structures

    • Include controls for antibody specificity using mutant tissues

  • Subcellular fractionation:

    • Separate cellular components through differential centrifugation

    • Identify OsI_03581 distribution using western blotting

    • Include markers for different cellular compartments as controls

  • Co-localization studies:

    • Use established markers for cellular compartments

    • Perform quantitative co-localization analysis

    • Consider super-resolution microscopy for detailed membrane localization

  • Temporal dynamics:

    • Examine localization changes during development

    • Monitor responses to environmental stressors, particularly salt stress

Based on studies of related proteins, researchers should pay particular attention to plasma membrane localization, especially in the Casparian strip domain of endodermal cells, and potential relocalization in response to stress conditions .

How can researchers address discordance between molecular and immunohistochemical data when studying OsI_03581?

When faced with discordance between molecular and immunohistochemical data in OsI_03581 research, researchers should implement a systematic troubleshooting approach:

  • Verify reagent quality and specificity:

    • Test antibody specificity using multiple controls (e.g., Oscasp1 mutant tissues as negative controls)

    • Validate primers for RT-qPCR using standard curves and melt curve analysis

    • Confirm the identity of recombinant proteins by mass spectrometry

  • Re-examine experimental procedures:

    • Review tissue preparation protocols for potential technical artifacts

    • Consider fixation effects on epitope accessibility for immunohistochemistry

    • Evaluate extraction methods for different tissue types

  • Address biological heterogeneity:

    • Examine potential tissue heterogeneity, as seen in some microsatellite instability studies where discordant cases presented tumor heterogeneity with distinct populations

    • Increase sampling across different regions of the tissue

    • Consider developmental timing and environmental conditions

  • Perform complementary analyses:

    • If discrepancies appear between protein detection and gene expression, check for post-transcriptional regulation

    • Use multiple detection methods (e.g., different antibodies or detection systems)

    • Consider alternative approaches (e.g., reporter gene constructs)

  • Statistical reassessment:

    • Increase sample size to improve statistical power

    • Review statistical methods for potential sources of bias

    • Consider consulting with a statistician for complex datasets

When reporting discordant results, transparently discuss potential sources of discrepancy and their biological implications rather than discarding data that doesn't fit expected patterns .

What are the common pitfalls in experimental design when studying OsI_03581 function and how can they be avoided?

Researchers studying OsI_03581 function should be aware of these common pitfalls and strategies to avoid them:

  • Inadequate controls:

    • Pitfall: Relying on single mutant lines or complementation constructs.

    • Solution: Use multiple independent mutant alleles (e.g., Oscasp1-1, Oscasp1-3, Oscasp1-4) and complementation lines to confirm phenotypes are specifically due to OsCASP1 disruption .

  • Improper tissue sampling:

    • Pitfall: Failing to account for developmental and spatial variation in expression.

    • Solution: Carefully select tissues based on expression patterns, focusing on small lateral roots where OsCASP1 is highly expressed .

  • Oversimplification of phenotypic analysis:

    • Pitfall: Focusing only on visible phenotypes without examining cellular and molecular changes.

    • Solution: Combine morphological observations with detailed cellular analyses of CS formation and suberin deposition .

  • Inappropriate method transfer from model systems:

    • Pitfall: Directly applying Arabidopsis methods to rice without validation.

    • Solution: Recognize that some techniques may need modification, such as propidium iodide penetration assays which work differently in rice compared to Arabidopsis .

  • Neglecting environmental variables:

    • Pitfall: Inconsistent growth conditions between experiments.

    • Solution: Standardize and carefully document all growth parameters, especially when studying stress responses.

  • Overlooking genetic background effects:

    • Pitfall: Attributing all phenotypic differences to the gene of interest.

    • Solution: Use appropriate wild-type controls with the same genetic background as mutant lines .

To ensure robust experimental design, researchers should follow the systematic approach outlined in experimental design literature, carefully defining variables, formulating specific hypotheses, designing appropriate treatments, assigning subjects to groups, and planning precise measurements .

How should researchers approach data normalization and statistical analysis when comparing wild-type and Oscasp1 mutant phenotypes?

When analyzing complex phenotypes like Casparian strip formation, consider developing quantitative metrics rather than relying solely on qualitative assessments. For example, measure fluorescence intensity profiles across cell walls, quantify the percentage of cells showing CS disruption, or establish a scoring system for different degrees of phenotypic severity .

How can CRISPR/Cas9 technology be utilized to study OsI_03581 function and generate precision mutants?

CRISPR/Cas9 technology offers powerful approaches for studying OsI_03581 function through the generation of precise genetic modifications:

When implementing CRISPR/Cas9 approaches, researchers should:

  • Carefully design guide RNAs to minimize off-target effects

  • Screen multiple independent lines to account for variation in editing outcomes

  • Perform comprehensive genotyping including sequencing and expression analysis

  • Consider tissue culture effects on regenerated plants

  • Maintain proper controls including wild-type segregants from the same transformation event

The literature already documents the successful use of CRISPR/Cas9 to generate Oscasp1-4 mutants targeting exon 1 of the OsCASP1 gene, providing a methodological foundation for further studies .

What metabolomic approaches can be used to study changes in suberin and lignin composition in Oscasp1 mutants?

Advanced metabolomic approaches offer powerful tools for analyzing suberin and lignin composition changes in Oscasp1 mutants:

  • Extraction and sample preparation techniques:

    • Isolate cell walls using enzymatic or mechanical methods

    • Perform sequential extraction to separate different cell wall components

    • Use specific solvent systems optimized for suberin and lignin extraction

    • Consider laser capture microdissection for tissue-specific analysis

  • Analytical platforms:

    • GC-MS (Gas Chromatography-Mass Spectrometry):

      • For analysis of suberin monomers after depolymerization

      • Requires derivatization of hydroxyl and carboxyl groups

    • LC-MS (Liquid Chromatography-Mass Spectrometry):

      • For analysis of intact or partially degraded polymers

      • Can be coupled with various ionization techniques (ESI, APCI)

    • Py-GC-MS (Pyrolysis GC-MS):

      • For direct analysis of complex polymers

      • Provides structural information about lignin composition

    • NMR Spectroscopy:

      • For detailed structural characterization

      • 2D NMR techniques can reveal linkage patterns in polymers

    • FTIR and Raman Spectroscopy:

      • For non-destructive analysis of chemical composition

      • Can be coupled with microscopy for spatial resolution

  • Data analysis approaches:

    • Multivariate statistical methods (PCA, PLS-DA) to identify patterns in complex data

    • Pathway analysis to connect metabolite changes to biological processes

    • Correlation networks to identify co-regulated compounds

  • Visualization techniques:

    • Develop staining protocols specific for different suberin and lignin components

    • Use fluorescence lifetime imaging to distinguish between different polymers

    • Apply chemical probes for specific functional groups

  • Integration with transcriptomics:

    • Correlate metabolite changes with expression of biosynthetic genes

    • Identify regulatory networks controlling suberin and lignin deposition

These approaches can reveal how OsCASP1 influences the composition and deposition patterns of cell wall modifications, providing deeper insights into its molecular function in barrier formation and environmental adaptation .

What are the future research directions for understanding OsI_03581's role in crop improvement for stress tolerance?

Future research on OsI_03581 holds significant potential for crop improvement, particularly for enhancing stress tolerance. Key research directions include:

  • Genetic diversity studies:

    • Screen diverse rice germplasm for natural variation in OsCASP1

    • Identify allelic variants associated with enhanced stress tolerance

    • Develop molecular markers for marker-assisted selection

  • Functional engineering approaches:

    • Fine-tune OsCASP1 expression using synthetic promoters responsive to specific stresses

    • Modify protein structure to enhance stability or function under stress conditions

    • Engineer optimized Casparian strip formation for improved nutrient uptake efficiency

  • Cross-species applications:

    • Transfer knowledge to other important crop species

    • Develop strategies to modulate CASP protein function in crops with different root architectures

    • Create synthetic CASP variants combining beneficial traits from multiple species

  • Integration with other stress tolerance mechanisms:

    • Study interactions between OsCASP1-mediated barrier formation and other stress response pathways

    • Develop pyramiding strategies combining multiple tolerance mechanisms

    • Investigate priming approaches to enhance stress-responsive expression

  • Field-level validation:

    • Test the performance of plants with modified OsCASP1 under field conditions

    • Assess stability of enhanced stress tolerance across environments

    • Evaluate potential trade-offs between stress tolerance and yield

  • Translational research:

    • Develop high-throughput screening methods for barrier function in breeding programs

    • Create computational models predicting optimal CS properties for different environments

    • Design targeted breeding strategies for environment-specific adaptations

  • Technological innovations:

    • Develop non-invasive phenotyping tools to monitor barrier formation

    • Create biosensors reporting on CS integrity and function

    • Apply systems biology approaches to model nutrient uptake under stress

These research directions would build upon current understanding that OsCASP1 orchestrates CS formation and suberin deposition, processes that are crucial for nutrient homeostasis and adaptation to challenging growth environments such as saline conditions .

Comparison of different recombinant OsI_03581 protein preparations

Product CodeProtein TypeSourceTag InformationPurityRecommended StorageShelf Life (Liquid)Shelf Life (Lyophilized)Reference
CSB-BP490237OFF1Recombinant Protein (Partial)BaculovirusDetermined during manufacturing>85% (SDS-PAGE)-20°C/-80°C6 months12 months
CSB-CF490237OFFTransmembrane Protein (Full length)E. coli expression systemN-terminal 10xHis-taggedNot specified-20°C/-80°C6 months12 months

Expression patterns of OsCASP1 in different tissues and conditions

Tissue TypeExpression LevelResponse to Salt StressCellular LocalizationReference
Small Lateral Root (SLR) TipsHighStrongly inducedNot specified
Primary Root TipModerateInducedNot specified
Younger RootsHighInducedNot specified
Stele (Root)ModerateStrongly inducedPrimarily in stele
SclerenchymaLowInducedDetectable after salt treatment
LeavesWeakInducedNot specified

Characteristics of different Oscasp1 mutant lines

Mutant LineGenetic BackgroundMutation TypeKey PhenotypesReference
Oscasp1-1NipponbareNot specifiedAltered CS formation, reduced salt tolerance
Oscasp1-3Indica (derived from Jinhui2629 and TR-2)Natural mutantWithered leaves, fewer tillers, delayed CS formation, altered suberin deposition
Oscasp1-4Not specifiedCRISPR/Cas9 (exon 1)Similar to other Oscasp1 mutants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.