Recombinant Oryza sativa subsp. indica CASP-like protein OsI_06397 (OsI_06397)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OsI_06397; CASP-like protein 2D1; OsCASPL2D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_06397
Target Protein Sequence
MRSGEGSTAAAAAAEEEKVKVAAPFRLAELGLRVCAVPLAVASVWEMATNKQVDETYGEV RFSDLSGFRYLVWINAITAAYSVASILLSSCRFITRFDWLIFILDQASAYLLLTSASAAA EVVYLAREGDREVSWGEVCSYFGRFCGAATVSVALNAAALLCFMALSLISAFRVFTKFNP PSQSNSKQQLSQEQGKPVVSG
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How do the transmembrane domains of OsI_06397 contribute to its biological function?

The transmembrane domains of OsI_06397 play critical roles in its function based on studies of related CASP proteins:

  • Membrane scaffold formation: The transmembrane regions enable the creation of stable membrane domains, forming "membrane fences" that compartmentalize the plasma membrane .

  • Cell wall modification: CASP proteins interact with peroxidases to direct localized lignin deposition, with the transmembrane domains likely facilitating these protein-protein interactions .

  • Diffusion barrier creation: In endodermal cells, related CASP proteins form domains that block lateral diffusion of membrane proteins and lipids .

To experimentally investigate transmembrane domain functions:

  • Generate deletion mutants lacking specific transmembrane domains

  • Perform site-directed mutagenesis of conserved residues

  • Create chimeric proteins swapping domains with other CASP family members

  • Use fluorescence recovery after photobleaching (FRAP) to measure domain stability

What expression systems are optimal for producing functional recombinant OsI_06397?

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli- Established protocol exists
- High yield potential
- Cost-effective
- May not preserve all post-translational modifications
- Potential inclusion body formation
- Use BL21(DE3) or C41/C43 strains
- Lower induction temperature (16-20°C)
- Include membrane-mimetic substances
Yeast (P. pastoris)- Eukaryotic folding machinery
- Better for membrane proteins
- Longer cultivation time
- More complex media
- Optimize codon usage
- Use inducible promoters
- Scale-up in bioreactors
Insect cells- Near-native protein folding
- Good for complex proteins
- Higher cost
- Technical complexity
- Optimize virus:cell ratio
- Harvest timing optimization
Plant-based systems- Native environment
- Authentic modifications
- Lower yield
- Longer production time
- Transient expression in N. benthamiana
- Use rice cell culture

The recombinant OsI_06397 has been successfully produced in E. coli with an N-terminal His-tag , confirming this as a viable expression system. For membrane proteins like OsI_06397, maintaining proper folding requires careful optimization of expression conditions.

What is the most effective experimental design for studying OsI_06397 localization and function?

An optimal experimental design for OsI_06397 functional studies should follow these principles based on experimental research frameworks :

  • Variables definition:

    • Independent variables: OsI_06397 expression levels, mutation status

    • Dependent variables: Membrane domain formation, protein interactions, phenotypic outcomes

    • Control variables: Growth conditions, genetic background

  • Hypothesis formulation:

    • Clearly define testable predictions about OsI_06397 function

    • Develop null and alternative hypotheses

  • Experimental treatments:

    • Generate transgenic rice plants with:

      • Knockout/knockdown of OsI_06397

      • Fluorescently tagged OsI_06397

      • Point mutations in key residues

      • Domain deletions/swaps

  • Subject assignment:

    • Use randomized complete block design

    • Include appropriate controls (wild-type, empty vector)

  • Measurement methods:

    • Confocal microscopy for localization

    • FRAP for membrane dynamics

    • Co-immunoprecipitation for protein interactions

    • Phenotypic analysis for functional outcomes

This experimental design framework ensures robust, reproducible results while controlling for extraneous variables that might influence outcomes .

How can CRISPR-Cas9 be optimized for functional studies of OsI_06397?

CRISPR-Cas9 technology provides powerful tools for studying OsI_06397 function. A comprehensive strategy should include:

  • Target site selection:

    • Prioritize conserved regions in transmembrane domains

    • Design multiple gRNAs targeting different exons

    • Use rice-optimized CRISPR tools with high editing efficiency

  • Modification strategies:

    • Complete gene knockout via frameshift mutations

    • Precise editing of conserved amino acids (especially in TM1 and TM3)

    • C-terminal tagging for visualization without function disruption

    • Domain deletions to assess specific functional contributions

  • Validation pipeline:

    • PCR-based genotyping of primary transformants

    • Sanger sequencing confirmation

    • qRT-PCR for transcript level analysis

    • Western blotting for protein expression

    • Phenotypic characterization across developmental stages

  • Functional characterization:

    • Microscopic analysis of membrane domain formation

    • Cell wall composition analysis (particularly lignin content)

    • Water transport and stress response assays

    • Protein-protein interaction studies

This approach allows for systematic dissection of OsI_06397 function while maintaining scientific rigor through comprehensive validation .

What methods can be used to assess protein-protein interactions involving OsI_06397?

Since CASP proteins interact with other proteins to form membrane domains and direct cell wall modifications , analyzing OsI_06397 interactions is crucial. Multiple complementary approaches are recommended:

  • In vivo interaction methods:

    • Split-GFP/YFP complementation in rice protoplasts

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Proximity labeling (BioID, TurboID) to identify interacting partners

  • Biochemical approaches:

    • Co-immunoprecipitation with anti-His antibodies (for recombinant protein)

    • Pull-down assays using purified OsI_06397

    • Cross-linking mass spectrometry

    • Blue native PAGE for membrane protein complexes

  • Library screening methods:

    • Yeast two-hybrid (for cytoplasmic domains)

    • Membrane yeast two-hybrid

    • Protein arrays with recombinant OsI_06397

  • Data analysis framework:

    • Filtering for high-confidence interactions

    • Network analysis of interaction partners

    • Functional classification of interactors

    • Validation of key interactions through multiple methods

When designing these experiments, consider that OsI_06397 likely interacts with peroxidases involved in lignin polymerization, similar to other CASP family proteins .

How is OsI_06397 evolutionarily related to other CASP-like proteins across plant species?

CASP-like proteins are found throughout land plants and green algae, with evolutionary relationships to MARVEL domain proteins in other kingdoms . For OsI_06397, evolutionary analysis should include:

  • Phylogenetic analysis:

    • Multiple sequence alignment of OsI_06397 with CASP/CASPL proteins

    • Construction of phylogenetic trees using maximum likelihood methods

    • Determination of orthologous relationships across species

  • Domain evolution:

    • Analysis of transmembrane domain conservation

    • Identification of lineage-specific motifs

    • Assessment of selection pressure on different protein regions

  • Functional divergence:

    • Comparison of expression patterns across species

    • Analysis of co-evolved gene networks

    • Correlation with emergence of specialized plant tissues

Research indicates that CASP proteins emerged coincident with the evolution of Casparian strips in land plants . Determining where OsI_06397 fits in this evolutionary trajectory provides insights into its specialized functions in rice.

What bioinformatic approaches can identify functional domains in OsI_06397?

To computationally predict functional domains in OsI_06397:

Analysis TypeTools/MethodsExpected Outcomes
Transmembrane topologyTMHMM, Phobius, TOPCONSPrediction of four transmembrane domains with specific orientation
Conserved domain identificationInterProScan, Pfam, SMARTIdentification of CASP/MARVEL domain boundaries
Evolutionary conservationConSurf, Rate4SiteIdentification of functionally important residues based on conservation
Protein interaction sitesSPRINT, PredictProteinPrediction of protein-binding regions
Structural modelingAlphaFold, SWISS-MODEL3D structural model revealing domain organization
Post-translational modificationsNetPhos, UbPredPrediction of potential regulatory sites

These predictions should be validated experimentally through:

  • Mutagenesis of predicted functional residues

  • Domain deletion/swapping experiments

  • Heterologous expression of isolated domains

  • Biochemical analysis of modified proteins

How can protein stability of recombinant OsI_06397 be maximized during purification and storage?

Based on product information , optimal handling of recombinant OsI_06397 requires:

  • Purification conditions:

    • Use Tris/PBS-based buffer at pH 8.0

    • Include 6% trehalose as a stabilizing agent

    • Maintain 4°C temperature throughout purification

    • Consider adding protease inhibitor cocktail

    • Use mild detergents for membrane protein solubilization

  • Storage recommendations:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Store at -20°C/-80°C

    • Prepare small working aliquots to avoid repeated freeze-thaw cycles

    • For short-term use, store aliquots at 4°C for up to one week

  • Stability assessment methods:

    • Thermal shift assays to identify stabilizing conditions

    • Size exclusion chromatography to monitor aggregation

    • Activity assays to confirm functional integrity

    • SDS-PAGE analysis to check for degradation

The recommended storage buffer (Tris/PBS with 6% trehalose) provides good stability, but additional stabilizing agents could be screened if longer-term stability is required .

What are the most common challenges in CASP-like protein research and how can they be addressed?

Research on CASP-like proteins presents several methodological challenges:

  • Membrane protein expression difficulties:

    • Challenge: Low expression levels and improper folding

    • Solution: Use specialized expression strains, optimize codons, adjust induction conditions, add stabilizing agents

  • Protein-protein interaction detection:

    • Challenge: Transient interactions in membrane environments

    • Solution: Use in vivo crosslinking, optimize detergent conditions, employ proximity labeling approaches

  • Functional redundancy:

    • Challenge: Multiple CASPL genes with overlapping functions

    • Solution: Generate multiple gene knockouts, perform complementation tests, use tissue-specific promoters

  • Subcellular localization complexity:

    • Challenge: Dynamic localization patterns change during development

    • Solution: Use time-lapse imaging, developmental stage-specific analysis, and conditional expression systems

  • Phenotype interpretation:

    • Challenge: Subtle or pleiotropic phenotypes

    • Solution: Use multiple phenotyping approaches, quantitative measurements, and stress conditions to reveal conditional phenotypes

These challenges require integration of multiple experimental approaches and careful experimental design to obtain reliable, reproducible results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.