Recombinant Oryza sativa subsp. indica CASP-like protein OsI_07795 (OsI_07795)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant OsI_07795 is produced in E. coli systems, purified using affinity chromatography, and formulated in Tris-based buffer with 50% glycerol . Key production details include:

  • Tagging: A fusion tag (unspecified type) is added during production to facilitate purification .

  • Purity: Not quantified in available sources, but standard recombinant protein protocols are implied .

  • Applications: Sold for research purposes, though specific experimental uses (e.g., ELISA, functional assays) are not detailed .

Evolutionary and Functional Context

While direct functional studies on OsI_07795 are lacking, insights can be inferred from CASP homologs:

  • Phylogenetic Classification: OsI_07795 clusters within the CASP_like subfamilies, which are evolutionarily conserved across land plants and green algae .

  • Role in Membrane Scaffolding: CASP-like proteins stabilize membrane domains to restrict diffusion of molecules and proteins, as demonstrated in Arabidopsis CASPs .

  • Potential Stress Adaptation: A watermelon CASPL ortholog (ClCASPL) and Arabidopsis AtCASPL4C1 influence cold tolerance, suggesting OsI_07795 may have roles in abiotic stress responses .

Research Gaps and Future Directions

  • Casparian Strip Association: CASP1-5 in Arabidopsis directly mediate lignin deposition for Casparian strip formation, but OsI_07795’s involvement remains unverified .

  • Genetic Redundancy: Functional analysis is complicated by potential redundancy among CASP-like genes, as seen in Arabidopsis casp1/casp3 double mutants .

  • Biotechnological Potential: Engineering CASP-like proteins could enhance nutrient uptake or stress resilience in crops, but targeted studies on OsI_07795 are needed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OsI_07795; Casparian strip membrane protein 5; OsCASP5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_07795
Target Protein Sequence
MEAGEEIEDGEPSTPTYKAHHPPPHLPPPMRSSGVSLVLSVADLVLRFVAIGGTAGSAIA MATTSETLPFAAPFVRFRAEYSDLPTLMFFVVASSVVCAYLVLSLPASVVHVVRPGARSS RAILAFLDTVMLALLTASASAAAAIVYLAHRGSARANWLGICQQFTSFCQRITASLVGSF AAAVVLVALVFLSALSLARRA
Uniprot No.

Target Background

Function

Function: Regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for the establishment of the Casparian strip membrane domain (CSD) and subsequent formation of Casparian strips. These cell wall modifications in the root endodermis create an apoplastic barrier between the intraorganismal and extraorganismal apoplasm, preventing lateral diffusion.

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant OsI_07795 typically produced for research applications?

Recombinant OsI_07795 is commonly produced using in vitro E. coli expression systems. The process involves cloning the OsI_07795 gene into an appropriate expression vector, transforming the construct into E. coli, inducing protein expression, and subsequently purifying the target protein. For research applications, the recombinant protein is typically tagged with an N-terminal 10xHis-tag to facilitate purification through affinity chromatography. The final product is provided either in liquid form or as a lyophilized powder, usually in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the optimal storage conditions for recombinant OsI_07795?

To maintain the stability and activity of recombinant OsI_07795, the protein should be stored at -20°C to -80°C. For long-term storage, aliquoting is necessary to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality. Under these conditions, the shelf life of the liquid form is approximately 6 months, while the lyophilized form remains stable for up to 12 months. For working solutions, storage at 4°C is recommended, but only for short periods up to one week .

How can OsI_07795 be incorporated into protein stability control systems in rice?

OsI_07795 can be incorporated into protein stability control systems like the RDDK-Shield1 (Shld1) system, which enables direct modulation of protein stabilization using synthetic small molecules. The methodology involves:

  • Creating a fusion construct where RDDK (containing an N-terminal arginine residue and a C-terminal lysine for proteasomal targeting) is linked to OsI_07795

  • Introducing the construct into rice via Agrobacterium-mediated transformation

  • Selecting homozygous transgenic lines through multiple generations

  • Applying the small molecule Shield1 (Shld1) to stabilize the fusion protein in a dose-dependent manner

This approach allows for reversible and spatio-temporally controlled accumulation of the fusion protein, providing a tunable system for studying OsI_07795 function in vivo. Protein accumulation can be verified through immunoblotting using appropriate antibodies and quantified through fluorescence intensity when using fluorescent tags .

What techniques are most effective for detecting OsI_07795 expression in plant tissues?

Several complementary techniques can be employed to detect OsI_07795 expression:

TechniqueApplicationSensitivityBenefitsLimitations
Western BlottingProtein level detectionHighQuantifiable, specificRequires specific antibodies
RT-qPCRTranscript level analysisVery highHighly sensitive, quantitativeDoesn't confirm protein presence
ImmunohistochemistryTissue localizationModerate-highSpatial informationRequires specific antibodies
GFP/YFP FusionLive visualizationModerateReal-time imagingMay affect protein function
ELISAProtein quantificationHighHighly quantitativeRequires specific antibodies

For optimal results, combine transcript analysis (RT-qPCR) with protein detection methods (Western blotting or ELISA) using anti-OsI_07795 antibodies or antibodies targeting fusion tags (His, HA, etc.) depending on the experimental construct .

How can the RDDK-Shld1 system be optimized for studying OsI_07795 function in rice?

Optimizing the RDDK-Shld1 system for OsI_07795 requires careful consideration of several factors:

What are the challenges in distinguishing the functions of OsI_07795 from other CASP-like proteins in rice?

Distinguishing the specific functions of OsI_07795 from other closely related CASP-like proteins presents several challenges:

  • Sequence similarity: CASP-like proteins often share significant sequence homology, making it difficult to develop specific tools for detecting only OsI_07795. Careful sequence analysis and alignment are essential to identify unique regions for designing specific primers or antibodies.

  • Functional redundancy: Multiple CASP-like proteins may have overlapping functions, complicating the interpretation of single-gene studies. Approaches to address this include:

    • Creating multiple knockout/knockdown lines

    • Performing complementation studies

    • Using the RDDK-Shld1 system for conditional expression

  • Spatio-temporal expression patterns: Different CASP-like proteins may be expressed in the same tissues but at different developmental stages or under different stress conditions. Comprehensive expression profiling across tissues, developmental stages, and stress conditions is necessary.

  • Protein-protein interactions: CASP-like proteins often function in complexes. Techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling can help identify specific interaction partners of OsI_07795 versus other CASP-like proteins .

How should experiments be designed to study OsI_07795 involvement in stress responses?

A comprehensive experimental design for studying OsI_07795 involvement in stress responses should include:

  • Expression analysis under multiple stresses:

    • Abiotic stresses: drought, salinity, heat, cold, nutrient deficiency

    • Biotic stresses: pathogen infection, herbivory

    • Time-course analysis: early (0-6h), intermediate (6-24h), and late (24-72h) responses

  • Genetic manipulation approaches:

    • RDDK-OsI_07795 lines for conditional expression

    • CRISPR/Cas9-generated knockouts

    • RNAi-mediated knockdowns

    • Overexpression lines

  • Phenotypic analysis:

    • Growth parameters: root length, shoot height, biomass

    • Physiological measurements: photosynthetic rate, transpiration, stomatal conductance

    • Biochemical analysis: ROS levels, antioxidant enzyme activities, osmolyte accumulation

    • Histochemical analysis: Casparian strip integrity using specific dyes

  • Molecular analysis:

    • Transcriptome profiling of wild-type vs. modified lines under stress

    • Protein interaction studies to identify stress-specific interaction partners

    • Post-translational modification analysis during stress responses

  • Controls and validation:

    • Include multiple independent transgenic lines

    • Compare with known stress-responsive genes/proteins

    • Validate key findings in different rice varieties

What are the appropriate controls for experiments using recombinant OsI_07795 in biochemical assays?

When using recombinant OsI_07795 in biochemical assays, the following controls should be implemented:

Control TypePurposeImplementation
Negative Protein ControlConfirm specificityUse an unrelated protein with similar size/tags
Tag-only ControlAssess tag interferenceExpress and purify the tag portion alone
Heat-inactivated ControlVerify activity dependencyHeat-treat aliquot of recombinant OsI_07795
Wild-type ExtractCompare to endogenous behaviorInclude extract from non-transformed tissue
Buffer ControlAccount for buffer effectsUse the same buffer without protein
Concentration GradientEstablish dose-responseTest multiple concentrations of recombinant protein
Stability ControlEnsure protein qualityFresh vs. stored protein comparison

For RDDK-Shld1 system experiments specifically, additional controls should include:

  • Mock-treated RDDK-OsI_07795 plants (no Shld1)

  • Wild-type plants treated with Shld1

  • Wild-type plants without Shld1 treatment

  • Plants segregating from transgenic lines without the RDDK-OsI_07795 transgene

How should researchers resolve contradictory findings between transcript and protein levels of OsI_07795?

Discrepancies between transcript and protein levels of OsI_07795 are not uncommon and may reveal important regulatory mechanisms. To resolve such contradictions:

  • Verify technical aspects:

    • Confirm primer and antibody specificity

    • Ensure appropriate reference genes/proteins for normalization

    • Validate results using alternative detection methods

  • Consider post-transcriptional regulation:

    • Analyze mRNA stability using actinomycin D chase experiments

    • Investigate potential microRNA targeting of OsI_07795 transcripts

    • Examine alternative splicing patterns

  • Investigate post-translational mechanisms:

    • Assess protein stability using cycloheximide chase assays

    • Analyze ubiquitination status to determine if protein is targeted for degradation

    • Examine potential proteolytic processing

  • Temporal considerations:

    • Perform detailed time-course analyses to identify potential delays between transcription and translation

    • Consider sampling at shorter intervals to capture rapid changes

  • Spatial analysis:

    • Compare whole-tissue analysis with cell-type specific approaches

    • Consider if protein transport between tissues could explain discrepancies

  • Integrated analysis approach:

    • Combine transcriptomics, proteomics, and potentially metabolomics data

    • Use bioinformatic tools to model regulatory networks affecting OsI_07795

What statistical approaches are most appropriate for analyzing OsI_07795 expression across different rice varieties and stress conditions?

When analyzing OsI_07795 expression across diverse conditions, robust statistical approaches are essential:

  • For comparing multiple varieties and treatments:

    • Two-way or multi-way ANOVA followed by appropriate post-hoc tests (Tukey's HSD for balanced designs; Scheffé's method for unbalanced designs)

    • Mixed-effects models when including random factors like experimental batches

  • For time-course experiments:

    • Repeated measures ANOVA for shorter time series

    • Generalized additive models (GAMs) for capturing non-linear expression patterns

    • Functional data analysis for continuous time-course data

  • For correlation analysis:

    • Pearson correlation for linear relationships between OsI_07795 and physiological parameters

    • Spearman rank correlation for non-parametric associations

    • Partial correlation to control for confounding variables

  • For multi-dimensional data:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Hierarchical clustering to identify groups of varieties with similar expression patterns

    • Network analysis to identify co-expressed genes

  • Power analysis considerations:

    • Determine optimal sample sizes based on expected effect sizes

    • Account for biological and technical replicates in variance estimation

    • Consider false discovery rate control for genome-wide comparisons

For all analyses, data visualization using heat maps, interaction plots, and expression profile graphs should complement the statistical results to facilitate interpretation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.