Recombinant Oryza sativa subsp. indica CASP-like protein OsI_17983 (OsI_17983)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. indica CASP-like protein OsI_17983 (OsI_17983)

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_17983 (OsI_17983) is a protein derived from the rice species Oryza sativa subsp. indica. It belongs to the Casparian strip membrane domain proteins (CASPs), which are crucial for the formation of the Casparian strip in plant endodermal cells. This structure plays a vital role in plant responses to environmental stresses by controlling ion and water transport across the root endodermis.

Characteristics of OsI_17983

  • Source and Host: The OsI_17983 protein is expressed in Escherichia coli (E. coli) as a recombinant protein, allowing for large-scale production for research purposes .

  • Tag: The protein is His-tagged, facilitating purification and detection using His-tag specific antibodies .

  • Protein Length: The full-length protein consists of 224 amino acids .

  • Purity: The recombinant protein has a purity greater than 90% as determined by SDS-PAGE .

Physicochemical Properties

PropertyDescription
Molecular WeightNot explicitly stated for OsI_17983, but CASP proteins in rice generally range between 16,092 Da and 20,747.65 Da .
Theoretical pIGenerally, CASP proteins have a pI ranging from 4.2 to 10.02 .
Amino Acid SequenceThe sequence starts with MSSGEPAAVSIPIHDHHGKAPATSSAVPAAAAAAPAAAPAVAPRKVGIPFFRRGDHHRGS RCLAFLDFILRIAAFGPALAAAISTGTSDETLSVFTEFYQFRARFDDFPAFLFFLVANAI VAGYLVLSLPFSAVLVIRPQTIGLRLLLLVCDMIMAAMLTAAASAAAAIVDLAHNGNLRA NWVAICMQFHGFCQRTSGSVVASFLTVVILMFLVILAACSIRKR .

Biological Functions

OsI_17983, as part of the CASP family, is involved in the formation of the Casparian strip, which is essential for maintaining root hydraulic integrity and controlling nutrient uptake. CASPs are also implicated in plant stress responses, including drought and salinity tolerance .

Research Findings

Recent studies have highlighted the importance of CASPs in rice and Arabidopsis for environmental stress responses. These proteins are highly expressed in root endodermal cells, suggesting a critical role in ion transport and stress adaptation . The presence of stress-responsive elements in CASP genes further supports their involvement in stress signaling pathways .

Application in Research

Recombinant OsI_17983 is used in life sciences research to study plant stress responses and the mechanisms underlying Casparian strip formation. It is available from various suppliers, such as Creative BioMart and CD BioSciences, facilitating experimental studies on its function and interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in the order notes for us to prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for precise delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
Shelf life is influenced by a variety of factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preference for a particular tag type, please let us know and we will prioritize its development.
Synonyms
OsI_17983; Casparian strip membrane protein 1; OsCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_17983
Target Protein Sequence
MSSGEPAAVSIPIHDHHGKAPATSSAVPAAAAAAPAAAPAVAPRKVGIPFFRRGDHHRGS RCLAFLDFILRIAAFGPALAAAISTGTSDETLSVFTEFYQFRARFDDFPAFLFFLVANAI VAGYLVLSLPFSAVLVIRPQTIGLRLLLLVCDMIMAAMLTAAASAAAAIVDLAHNGNLRA NWVAICMQFHGFCQRTSGSVVASFLTVVILMFLVILAACSIRKR
Uniprot No.

Target Background

Function
This protein plays a crucial role in regulating membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips. Casparian strips are specialized cell wall modifications found in the root endodermis that act as an apoplastic barrier between the internal apoplasm and the external apoplasm. This barrier prevents lateral diffusion, effectively controlling the movement of substances within the plant.
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OsI_17983 and what is its basic structure?

OsI_17983 is a CASP-like protein from Oryza sativa subsp. indica comprising 224 amino acids in its full-length form . It belongs to the larger family of Casparian strip membrane domain proteins (CASPs), which are critical transmembrane proteins involved in forming specialized cell wall modifications in plant roots. These proteins typically contain transmembrane domains that anchor them to the plasma membrane, where they function as scaffolds for recruiting enzymes necessary for Casparian strip formation . For recombinant expression, the full-length protein (amino acids 1-224) can be produced in E. coli with a His-tag for purification purposes .

How does OsI_17983 relate to other CASP proteins in rice?

OsI_17983 is one of 41 identified CASP and CASP-like genes in the rice genome, which have been phylogenetically grouped into six distinct subgroups . Comparative genomic analyses have revealed that these proteins evolved primarily through whole genome duplication (WGD) events, with some tandem duplication (TD) contributing to their diversification . OsI_17983 shares functional similarities with other rice CASP proteins, particularly with OsCASP1, though their specific relationships require further characterization. Recent research has shown that most rice CASP genes contain MYB binding motifs in their promoters, suggesting common regulatory mechanisms .

What is the primary cellular location of OsI_17983 expression?

Like other CASP proteins, OsI_17983 is predominantly expressed in root tissues, with particularly high expression in endodermal cells . This localization aligns with its presumed function in Casparian strip formation, which occurs specifically in the endodermis. RNA-seq analyses of rice tissues have demonstrated that while several OsCASP genes show broader expression patterns, the highest expression levels are observed in root endodermal cells, where Casparian strips are actively forming . This tissue-specific expression pattern is critical for understanding the protein's functional context.

How does OsI_17983 contribute to plant stress responses?

CASP-like proteins, including OsI_17983, are implicated in plant responses to environmental stresses, particularly those affecting nutrient and water uptake . Research on OsCASP1 has demonstrated that defects in this protein lead to altered ion balance and reduced tolerance to salt stress . The endodermal barrier, which CASP proteins help establish, plays a critical role in selective nutrient uptake and stress adaptation. RT-qPCR analyses have suggested that several OsCASP genes, potentially including OsI_17983, may be particularly responsive to ion deficiency conditions , indicating their importance in maintaining nutrient homeostasis under challenging environmental conditions.

What are the known protein interactions of OsI_17983?

While direct interaction studies for OsI_17983 are not provided in the search results, insights from related proteins can be informative. CASP proteins typically interact with peroxidases and other enzymes involved in lignin polymerization . In Arabidopsis, CASP proteins form homo- and heteromeric complexes that create a protein scaffold in the plasma membrane. For rice CASP proteins, studies on OsCASP1 suggest interaction with lignin biosynthetic machinery, though whether OsCASP1 forms scaffolds with itself or other OsCASPs requires further investigation . Protein database searches for related rice proteins indicate potential interactions with ubiquitin-conjugating enzymes and methyltransferases , suggesting roles in protein modification and gene regulation networks.

What are the optimal conditions for recombinant expression of OsI_17983?

Recombinant OsI_17983 can be efficiently expressed in E. coli expression systems with a His-tag to facilitate purification . For optimal expression, researchers should consider using BL21(DE3) or similar strains designed for high-level protein expression. Induction is typically performed with IPTG (0.5-1.0 mM) when cultures reach mid-log phase (OD600 ~0.6-0.8), with expression conducted at lower temperatures (16-25°C) to enhance protein solubility. Purification can be performed using nickel affinity chromatography followed by size exclusion chromatography to obtain highly pure protein. For functional studies, it's important to verify protein folding through circular dichroism or similar techniques.

What visualization techniques are most effective for studying OsI_17983's role in Casparian strip formation?

Based on research methods used for related CASP proteins, several visualization techniques prove effective for studying Casparian strip formation:

  • Fluorescent protein tagging: Creating OsI_17983-GFP fusion constructs for in vivo localization studies can reveal its subcellular distribution patterns.

  • Berberine-aniline blue staining: This improved method allows visualization of CS in rice roots, though researchers should note that surface observation of small lateral roots (SLRs) may not reveal CS structures .

  • Basic Fuchsin and Calcofluor White staining: After ClearSee solution treatment, these stains can provide clear visualization of CS structure in whole-mount observations of rice roots .

  • Propidium iodide (PI) penetration assays: While commonly used for Arabidopsis, researchers should note that rice roots can hinder but not completely prevent PI entry into the stele, making this technique less definitive for rice CS integrity assessment .

How can researchers effectively investigate OsI_17983 function through genetic approaches?

For comprehensive functional characterization of OsI_17983, researchers should consider these genetic approaches:

  • CRISPR/Cas9 mutagenesis: Generate targeted knockouts of OsI_17983, focusing on exon regions likely to disrupt protein function. The search results indicate successful generation of OsCASP1 mutants using this approach .

  • Complementation experiments: For validating mutant phenotypes, develop constructs containing the native promoter and full coding sequence (OsI_17983pro:OsI_17983) for transformation into mutant backgrounds .

  • Promoter-reporter fusions: Create OsI_17983pro:GUS constructs to analyze tissue-specific expression patterns under various environmental conditions .

  • RT-qPCR analysis: Examine expression changes of OsI_17983 and related genes under different stress conditions, particularly focusing on nutrient deficiency and salt stress responses .

How does OsI_17983 function differ from Arabidopsis CASP proteins?

Rice and Arabidopsis exhibit significant differences in root structure and Casparian strip formation, which likely reflect functional differences in their respective CASP proteins . Research indicates that CS formation in rice occurs earlier than in Arabidopsis, suggesting different temporal regulation . Unlike Arabidopsis, rice roots show strong fluorescence in the sclerenchyma in addition to the endodermis when stained for lignin deposition, indicating unique tissue-specific roles for rice CASP proteins . Additionally, propidium iodide permeability differs between rice and Arabidopsis roots, with rice roots hindering but not completely preventing PI entry into the stele . These differences highlight the importance of studying rice-specific CASP proteins like OsI_17983 rather than simply extrapolating from Arabidopsis models.

What approaches can be used to study the role of OsI_17983 in suberin deposition?

Suberin deposition is a critical process associated with CASP protein function that can be investigated through:

  • Fluorol Yellow staining: This technique allows visualization of suberin lamellae in root tissues, enabling comparison between wild-type and OsI_17983-mutant plants.

  • Gas chromatography-mass spectrometry (GC-MS): This approach can quantify suberin monomers from root tissues to determine if OsI_17983 affects suberin composition or abundance.

  • Gene expression analysis: RT-qPCR examining suberin biosynthesis genes (such as those encoding fatty acid elongases, CYP86A, and GPAT) in OsI_17983 mutants can reveal regulatory relationships. Studies on OsCASP1 have shown altered expression of genes involved in suberin biosynthesis in mutant plants .

  • Transmission electron microscopy: This technique can reveal ultrastructural changes in suberin lamellae formation in mutant versus wild-type endodermal cells.

How might OsI_17983 manipulation improve crop resistance to environmental stressors?

Based on the role of CASP proteins in stress responses, several research directions for crop improvement emerge:

  • Stress-inducible expression: Engineering stress-responsive promoters to control OsI_17983 expression could enhance stress adaptation without growth penalties under normal conditions.

  • Targeted expression modification: Altering OsI_17983 expression specifically in root tissues might improve nutrient uptake efficiency and salt stress tolerance, as CASP proteins play crucial roles in nutrient homeostasis and environmental adaptation .

  • Natural variation analysis: Examining OsI_17983 sequence and expression differences across rice varieties with varying stress tolerance could identify favorable alleles for breeding programs.

  • Co-expression manipulation: Since CASP proteins work in concert with other proteins, coordinated modification of OsI_17983 along with interacting partners might yield more robust stress resistance.

What are the current limitations in OsI_17983 research?

Current research on OsI_17983 specifically is limited, with more extensive characterization available for related proteins like OsCASP1. Key knowledge gaps include:

  • Precise functional characterization: Direct evidence of OsI_17983's specific role in CS formation versus that of other CASP family members is lacking.

  • Protein interaction network: Comprehensive protein-protein interaction studies for OsI_17983 are needed to understand its position in cellular signaling networks.

  • Genetic redundancy: The extent of functional overlap between OsI_17983 and other CASP-like proteins remains poorly characterized, complicating single-gene studies.

  • Translational research: Applications of OsI_17983 research for crop improvement are still in preliminary stages, requiring field validation.

What emerging techniques could advance OsI_17983 research?

Several cutting-edge approaches hold promise for deepening our understanding of OsI_17983:

  • Single-cell transcriptomics: This could reveal cell-type-specific expression patterns of OsI_17983 with unprecedented resolution, particularly in complex root tissues.

  • Proximity labeling techniques: Methods like BioID or TurboID could identify transient or weak interactors of OsI_17983 in planta.

  • Cryo-electron microscopy: This could potentially resolve the structure of OsI_17983 complexes at the Casparian strip membrane domain.

  • Genome editing with base editors or prime editors: These could enable precise modification of OsI_17983 regulatory elements to fine-tune expression under specific conditions.

  • Computational modeling: Protein structure prediction using AlphaFold2 or similar tools could provide insights into OsI_17983 function when crystal structures are unavailable.

How do evolutionary aspects of OsI_17983 inform functional studies?

Evolutionary analysis of OsI_17983 can provide valuable research context:

  • Comparative genomics: Studies have identified 41 CASP genes in rice compared to 39 in Arabidopsis, with whole genome duplication events playing a major role in their evolution .

  • Functional divergence: Analyzing selection pressure across different domains of OsI_17983 can identify functionally important regions that have been conserved during evolution.

  • Promoter evolution: Analysis of cis-regulatory elements, particularly MYB binding motifs identified in most OsCASP genes , can reveal evolutionary shifts in expression regulation.

  • Structural conservation: Comparing transmembrane domain organization across species can highlight functionally critical features for CASP protein function across diverse plant lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.