Recombinant Oryza sativa subsp. indica CASP-like protein OsI_30044 (OsI_30044)
Description
Protein Structure and Properties
OsI_30044 is classified as a CASP-like protein identified in Oryza sativa subsp. indica. The commercially available recombinant form is typically supplied in quantities of 50 μg, though other amounts may be requested . This protein is stored in a Tris-based buffer with 50% glycerol, specifically optimized to maintain its stability and functionality .
Like other members of the CASP family, OsI_30044 likely functions as part of a transmembrane scaffold that recruits lignin biosynthetic enzymes necessary for Casparian strip formation . The protein contains characteristic domains that facilitate its localization to the plasma membrane, where it performs its biological functions.
For research applications, proper storage of the recombinant protein is essential to maintain its integrity. The recommended storage conditions include keeping the protein at -20°C, with options for extended storage at either -20°C or -80°C . To preserve functionality, repeated freezing and thawing should be avoided, and working aliquots should be maintained at 4°C for no more than one week .
Gene Expression and Regulation
The gene encoding OsI_30044 is designated according to the ORF naming convention as OsI_30044 . It belongs to a larger family that includes 41 identified OsCASP genes in rice, which have been classified into six distinct subgroups based on sequence homology and evolutionary relationships .
Recent comparative analysis of CASP genes in rice and Arabidopsis has revealed important patterns in their expression and regulation. Most OsCASP genes contain MYB binding motifs in their promoter regions, suggesting common regulatory mechanisms . RNA-seq data indicates that the majority of OsCASP genes are predominantly expressed in roots, particularly in endodermal cells, consistent with their role in Casparian strip formation .
While specific expression data for OsI_30044 is limited, studies on related CASP proteins, such as OsCASP1, have shown that their expression can be induced by environmental stressors, particularly salt stress . This stress-responsive expression pattern highlights the importance of CASP proteins in plant adaptation to challenging environmental conditions.
Role in Casparian Strip Formation
CASP proteins, including OsI_30044, play a fundamental role in the formation of Casparian strips (CS) in plant roots. These specialized cell wall modifications create paracellular diffusion barriers that control the movement of water and solutes between the soil solution and vascular tissues .
In Arabidopsis, CASP proteins form a transmembrane scaffold that recruits lignin biosynthetic enzymes necessary for CS formation . While the specific function of OsI_30044 has not been extensively documented, studies on other rice CASP proteins provide insight into their collective role in this process. Research on OsCASP1, for instance, has demonstrated its significance in proper CS formation in rice roots .
Rice presents a more complex root structure than Arabidopsis, with differences in the timing of CS appearance and structure . The CS in rice roots appears to form differently, particularly in terms of lignin and suberin deposition patterns. Studies of OsCASP1 mutants have revealed delayed CS formation and uneven lignin deposition in small lateral roots, suggesting that CASP proteins orchestrate the proper timing and structure of CS development .
This process is particularly important for rice, which is often grown in semi-aquatic conditions requiring sophisticated control of water and nutrient uptake through the root system. The proper formation of CS contributes significantly to the plant's ability to maintain nutrient homeostasis and adapt to various growth environments .
Involvement in Suberin Deposition
Beyond their role in CS formation, CASP proteins in rice are also involved in regulating suberin deposition in the endodermis and sclerenchyma . Suberin is a complex biopolymer that functions as a barrier to water and solute movement, making its deposition crucial for plant adaptation to environmental stresses, particularly in controlling ion uptake and water loss .
Research on OsCASP1 has demonstrated that its loss of function alters the expression of genes involved in suberin biosynthesis, subsequently affecting suberin deposition in the endodermis and sclerenchyma . As a member of the CASP family, OsI_30044 likely contributes to similar processes, though specific studies on its role in suberin deposition are not extensively documented in the available literature.
The differential deposition of lignin and suberin in rice roots is essential for adaptive responses to growth conditions. This process is particularly important for regulating nutrient uptake and maintaining ion balance . Disruption of this process, as observed in OsCASP1 mutants, can lead to ion imbalance resulting in withered leaves, fewer tillers, and reduced tolerance to salt stress—all of which significantly impact plant health and productivity .
Impact on Plant Stress Tolerance
CASP proteins, including members like OsI_30044, have emerged as important factors in plant stress tolerance, particularly in response to salt stress. Studies have shown that OsCASP1 expression is induced by salt stress, especially in the steles of small lateral roots . This stress-responsive expression pattern underscores the role of CASP proteins in adaptive responses to environmental challenges.
The formation of properly structured Casparian strips and the controlled deposition of suberin are crucial for maintaining nutrient homeostasis under stress conditions. These processes help regulate ion uptake and prevent excessive accumulation of potentially toxic elements in plant tissues. Disruption of these processes, as observed in CASP mutants, can compromise the plant's ability to maintain ion balance, leading to reduced stress tolerance .
Genetic studies involving OsCASP1 mutants have demonstrated phenotypic consequences that include withered leaves, reduced tillering, and decreased salt tolerance . These observations highlight the importance of CASP proteins in maintaining plant health and productivity under challenging conditions, suggesting similar roles for related proteins like OsI_30044.
Relationship to Other CASP Proteins
OsI_30044 belongs to the larger CASP protein family in rice, which includes at least 41 identified OsCASP genes . These genes have been classified into six distinct subgroups based on sequence homology and evolutionary relationships . The classification of OsI_30044 as a "CASP-like" protein suggests some degree of sequence divergence from canonical CASP proteins, though it likely retains core functional characteristics.
Structural and functional studies of CASP proteins in rice have revealed important insights into their collective roles. For instance, OsCASP1 has been shown to form complexes with itself and with OsCASP2, leading to ectopic protein accumulation when expressed under the control of the 35S promoter . This suggests that CASP proteins, potentially including OsI_30044, may function as part of larger protein complexes rather than as individual entities.
The functional diversity within the CASP family allows for specialized roles in different tissues and developmental stages. Some members, like OsCASP_like11/9, demonstrate pronounced expression in endodermal cells, suggesting specific involvement in endodermis CS formation . Others, such as OsCASP_like2/3/13/17/21/30, have been identified as candidate genes for ion defect processes, highlighting their potential role in maintaining ion homeostasis .
Evolutionary Significance
Comprehensive analysis of the CASP gene family in rice and Arabidopsis has provided valuable insights into their evolutionary history. Collinearity analysis has underscored the pivotal roles of whole genome duplication (WGD) and tandem duplication (TD) events in driving the evolution of CASP proteins, with WGDs being the dominant force . This evolutionary pattern has contributed to the expansion and diversification of the CASP gene family, leading to the development of specialized functions in different plant species.
The parallel evolution of CASP proteins in rice and Arabidopsis is evidenced by the similar number of genes (41 in rice, 39 in Arabidopsis) and their organization into six distinct subgroups . This conservation across species underscores the fundamental importance of CASP proteins in plant development and adaptation.
This evolutionary conservation highlights the importance of CASP proteins, including OsI_30044, in fundamental plant processes related to root development and nutrient uptake regulation. The diversification within the family likely reflects adaptations to different environmental conditions and physiological requirements.
Recombinant Production and Availability
Recombinant OsI_30044 protein serves as a valuable research tool for investigating the structure and function of CASP proteins in rice. The commercially available form is typically supplied in quantities of 50 μg, with other quantities available upon request . The protein is produced with a tag type determined during the production process, which may include common tags such as His, GST, or MBP to facilitate purification and detection .
The recombinant protein is supplied in a Tris-based buffer with 50% glycerol, specifically formulated to maintain its stability . Proper storage conditions are essential for preserving protein functionality, with recommendations including storage at -20°C for regular use and -20°C or -80°C for extended storage . Working aliquots should be maintained at 4°C and used within one week to ensure optimal activity .
The production of recombinant CASP proteins involves expression in heterologous systems, followed by purification steps to obtain the protein in a functional form. This process enables researchers to study the protein's properties and functions in controlled experimental settings, offering insights that might be difficult to obtain through in vivo studies alone.
Research Applications
Recombinant OsI_30044 and other CASP proteins have significant applications in various areas of plant biology research. These applications include:
-
Structural Studies: Recombinant proteins facilitate detailed analysis of protein structure using techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy, providing insights into the structural basis of CASP protein function.
-
Protein-Protein Interaction Analysis: Recombinant CASP proteins can be used in assays such as co-immunoprecipitation and yeast two-hybrid screens to identify interaction partners, elucidating the molecular networks involved in CS formation and suberin deposition.
-
Antibody Production: Recombinant proteins serve as antigens for generating specific antibodies, which are valuable tools for detecting and studying endogenous CASP proteins in plant tissues.
-
Functional Assays: In vitro assays using recombinant proteins help characterize enzymatic activities and regulatory mechanisms associated with CASP protein function.
-
Transgenic Studies: Recombinant proteins can be used as controls in studies involving transgenic plants with altered CASP protein expression, providing reference points for phenotypic and molecular analyses.
Implications for Rice Agriculture
Research on CASP proteins, including OsI_30044, has significant implications for rice agriculture, particularly in developing varieties with enhanced stress tolerance. Studies on OsCASP1 have shown that its loss of function leads to phenotypes including withered leaves, fewer tillers, and reduced tolerance to salt stress —characteristics that directly impact crop yield and quality.
The role of CASP proteins in regulating nutrient uptake and ion homeostasis is particularly relevant for rice cultivation, which often occurs in environments with varying nutrient availability and potential exposure to salt stress . Understanding the function of OsI_30044 and related proteins could identify targets for genetic improvement of rice varieties, aimed at enhancing nutrient use efficiency and stress tolerance.
Additionally, the involvement of CASP proteins in CS formation and suberin deposition represents a potential target for optimizing water and nutrient uptake in rice. This optimization could contribute to enhanced resource use efficiency and reduced environmental impacts of rice cultivation—increasingly important considerations in the context of sustainable agriculture and adaptation to changing climate conditions.
Product Specs
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare according to your specifications.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
Q&A
What is the biological function of CASP-like protein OsI_30044?
CASP-like protein OsI_30044 belongs to the Casparian strip membrane domain protein family found in rice (Oryza sativa subsp. indica). These proteins are pivotal for the formation of the Casparian strip (CS) in endodermal cells and play a crucial role in a plant's response to environmental stresses . The Casparian strip forms a barrier in the endodermis, controlling the selective uptake of nutrients and water while preventing the passive flow of harmful substances into the vascular tissues.
The specific OsI_30044 protein is part of the larger CASP gene family in rice, which contains 41 identified members (compared to 39 AtCASP genes in Arabidopsis) . While the exact function of OsI_30044 has not been individually characterized in the available literature, it likely contributes to the structural integrity of the Casparian strip based on its homology to other CASP proteins.
What is the amino acid sequence of Recombinant OsI_30044?
The full amino acid sequence of CASP-like protein OsI_30044 is as follows:
MVELESQEAVTVASTADIAVDVSLRLLAAATSLASAVVVAANHQQRWGVRVDFTLFQVWIGFVAVNLVCTVYAAATAAAARKAMGRWWLHHADAVVVNLEAAATAGAGAIGSIAMWGNEASGWYAVCRLYRRYCNAGAAALALSLAAVLLLGVACARSRYPKMPPTT
This protein has 167 amino acids in its full-length form and is associated with UniProt accession number A2YXI1 . The expression region for the recombinant protein encompasses residues 1-167 .
How are CASP-like proteins classified in rice?
CASP-like proteins in rice (OsCASP) are classified through bioinformatics analysis into six distinct subgroups based on their sequence similarities and evolutionary relationships . This classification system has been established through comprehensive genomic analysis that identified 41 OsCASP genes in the rice genome.
The classification is primarily based on:
-
Sequence homology
-
Phylogenetic analysis
-
Domain architecture
-
Evolutionary history
Collinearity analysis has revealed that whole genome duplication (WGD) and tandem duplication (TD) events have been pivotal in driving the evolution of CASPs, with WGDs being the dominant force in this evolutionary process . This explains the relatively large size of the CASP gene family in rice compared to other plant species.
What is the tissue-specific expression pattern of OsI_30044?
While the specific expression pattern of OsI_30044 is not individually detailed in the available search results, RNA-seq analysis of the CASP gene family in rice has revealed that the majority of OsCASP genes are highly expressed in roots, particularly in endodermal cells . This expression pattern is consistent with their function in Casparian strip formation.
Among the CASP genes, OsCASP_like11/9 demonstrated particularly pronounced expression in endodermal cells, suggesting their potential involvement in the formation of the endodermis Casparian strip . Though OsI_30044 is not specifically mentioned among these highly expressed genes, its expression pattern likely follows the general trend of root-specific expression typical of CASP family proteins.
What cis-regulatory elements control CASP-like protein expression?
Analysis of cis-elements in the promoter regions of CASP genes has indicated that most OsCASP genes contain MYB binding motifs . These transcription factor binding sites are likely important for the regulation of CASP gene expression in response to developmental cues and environmental stresses.
The presence of MYB binding motifs suggests that MYB transcription factors may be key regulators of CASP gene expression. MYB transcription factors are known to be involved in various aspects of plant development and stress responses, including the regulation of secondary cell wall formation, which is relevant to Casparian strip development.
A comprehensive analysis of the regulatory mechanisms would require:
-
Promoter analysis of specific CASP genes
-
Identification of transcription factors that bind to these promoters
-
Characterization of signaling pathways that activate these transcription factors
-
Analysis of expression patterns under various environmental conditions
What is the optimal method for expression and purification of recombinant OsI_30044?
The recombinant OsI_30044 protein is typically produced using an in vitro E. coli expression system . This prokaryotic expression system is preferred due to its high yield, ease of genetic manipulation, and cost-effectiveness for producing plant proteins that do not require post-translational modifications for experimental purposes.
For optimal expression and purification, the following methodology is recommended:
-
Cloning: The coding sequence of OsI_30044 (residues 1-167) should be PCR-amplified and cloned into an appropriate expression vector with a fusion tag (such as His-tag or GST-tag) to facilitate purification.
-
Expression conditions:
-
E. coli strain: BL21(DE3) or similar expression strains
-
Induction: 0.5-1 mM IPTG when culture reaches OD600 of 0.6-0.8
-
Temperature: 16-18°C post-induction for 16-20 hours to enhance soluble protein production
-
Media: LB or 2xYT supplemented with appropriate antibiotics
-
-
Purification strategy:
-
Affinity chromatography (based on the fusion tag)
-
Size exclusion chromatography to remove aggregates
-
Ion exchange chromatography for further purification if needed
-
-
Storage buffer: Tris-based buffer with 50% glycerol as used for the commercial product .
-
Storage conditions: Store at -20°C for short-term or -80°C for long-term storage; avoid repeated freeze-thaw cycles .
How can researchers validate the function of OsI_30044 in planta?
To validate the function of OsI_30044 in plants, researchers should employ multiple complementary approaches:
-
Gene knockout or knockdown studies:
-
CRISPR/Cas9-mediated gene editing to create loss-of-function mutants
-
RNAi-mediated gene silencing for partial loss of function
-
Analysis of phenotypic effects on Casparian strip formation and function
-
-
Complementation assays:
-
Transform mutant plants with the wild-type OsI_30044 gene to confirm phenotype rescue
-
Cross-species complementation with Arabidopsis casp mutants to test functional conservation
-
-
Protein localization:
-
Generate transgenic plants expressing OsI_30044 fused to a fluorescent reporter
-
Perform confocal microscopy to analyze subcellular localization
-
Co-localization studies with known Casparian strip markers
-
-
Functional assays:
-
Apoplastic tracer uptake assays to assess Casparian strip integrity
-
Ion content analysis to evaluate selective nutrient uptake
-
Stress tolerance tests to assess the response to environmental challenges
-
-
Protein interaction studies:
-
Yeast two-hybrid or BiFC to identify protein interaction partners
-
Co-immunoprecipitation to confirm in vivo interactions
-
Pull-down assays with recombinant protein to validate direct interactions
-
How can OsI_30044 be used to study ion homeostasis in rice?
Given the role of CASP proteins in forming the Casparian strip, which regulates ion movement in plant roots, OsI_30044 can be utilized as a research tool to study ion homeostasis in rice through several experimental approaches:
-
Genetic modification approaches:
-
Create OsI_30044 overexpression lines to examine effects on ion transport
-
Generate knockout mutants using CRISPR/Cas9 to assess loss-of-function effects
-
Develop inducible expression systems to control timing of CASP protein activity
-
-
Ion uptake and translocation analysis:
-
Measure uptake of radioactive isotopes or ICP-MS analysis of various ions
-
Compare ion content in different tissues between wild-type and modified plants
-
Conduct time-course experiments to assess dynamics of ion movement
-
-
Physiological response assessment:
-
Expose plants to ion deficiency or toxicity conditions
-
Measure growth parameters, photosynthetic efficiency, and stress markers
-
Analyze root system architecture changes in response to ion availability
-
RT-qPCR results have demonstrated that several OsCASP_like genes (specifically OsCASP_like2/3/13/17/21/30) may be candidate genes involved in the ion defect process . While OsI_30044 is not specifically mentioned in this group, similar experimental approaches can be applied to study its potential role in ion homeostasis.
What experimental designs are appropriate for studying OsI_30044 function under stress conditions?
To study the function of OsI_30044 under stress conditions, researchers should implement well-controlled experimental designs that isolate the effects of specific stressors while maintaining rigorous controls. Based on established experimental design principles , the following approach is recommended:
-
Variables definition:
-
Independent variable (IV): Type and intensity of stress (e.g., salt concentration at 0, 50, 100, 150 mM)
-
Dependent variable (DV): OsI_30044 expression levels, plant physiological responses
-
Controlled variables: Growth conditions, plant age, genetic background
-
Constants: Light cycle, nutrient solution composition, temperature
-
-
Experimental groups:
-
Wild-type plants (control)
-
OsI_30044 knockout or knockdown plants
-
OsI_30044 overexpression plants
-
Complementation lines (knockout restored with wild-type gene)
-
-
Stress treatment design:
-
Abiotic stresses: Drought, salinity, heat, cold, heavy metals
-
Biotic stresses: Pathogen infection, herbivory
-
Combined stresses: Drought + heat, salinity + pathogen
-
-
Time-course analysis:
-
Short-term responses (hours to days)
-
Long-term adaptation (weeks to months)
-
Recovery phase after stress removal
-
-
Multi-level analysis:
-
Molecular: Gene expression, protein levels, post-translational modifications
-
Cellular: Casparian strip integrity, endodermal cell morphology
-
Tissue: Root architecture, vascular development
-
Whole plant: Growth parameters, yield components
-
To avoid experimental design pitfalls, researchers should ensure:
-
Adequate replication (minimum n=5 for each condition)
-
Randomized experimental units
-
Inclusion of proper controls for each experimental factor
-
Standardized growth and treatment conditions
-
Appropriate statistical analysis methods
How does OsI_30044 compare structurally and functionally to other CASP family members?
A comprehensive comparative analysis reveals both structural and functional relationships between OsI_30044 and other CASP family members:
Structural comparison:
CASP proteins typically share a conserved membrane domain architecture with multiple transmembrane segments. OsI_30044, with its 167 amino acids , likely adopts a similar topology to other CASP proteins, though specific structural studies on this particular protein are not detailed in the available search results.
A comparative analysis would include:
-
Sequence alignment with other CASP proteins to identify conserved domains
-
Prediction of transmembrane segments and topology
-
Identification of protein-protein interaction motifs
-
Analysis of post-translational modification sites
Functional comparison:
The comprehensive study of CASP genes in rice and Arabidopsis identified 41 OsCASP and 39 AtCASP genes, which were grouped into six distinct subgroups based on sequence similarity and potentially shared functions . Within this family, different members show specialized expression patterns and potentially distinct functions:
-
OsCASP_like11/9 and AtCASP_like1/31 showed pronounced expression in endodermal cells, suggesting their involvement in endodermis CS formation
-
OsCASP_like2/3/13/17/21/30 may be candidate genes involved in the ion defect process
While the specific subgroup and functional specialization of OsI_30044 is not explicitly mentioned in the search results, its relationship to these well-characterized members could be determined through phylogenetic analysis and expression pattern comparison.
What evolutionary insights can be gained from studying OsI_30044 and related CASP genes?
Evolutionary analysis of the CASP gene family provides valuable insights into plant adaptation mechanisms:
-
Evolutionary mechanisms:
Collinearity analysis of CASP genes has underscored the pivotal roles of whole genome duplication (WGD) and tandem duplication (TD) events in driving the evolution of CASPs, with WGDs being the dominant force . This suggests that the expansion of the CASP gene family has been an important aspect of plant genome evolution. -
Phylogenetic relationships:
The organization of CASP genes into six distinct subgroups indicates evolutionary diversification that likely reflects functional specialization . Comparing OsI_30044 with its homologs in other species could reveal:-
Conserved regions indicating functional importance
-
Variable regions suggesting adaptive evolution
-
Selection pressures acting on different protein domains
-
-
Comparative genomics approach:
To gain evolutionary insights, researchers should:-
Construct phylogenetic trees including CASP genes from diverse plant species
-
Calculate selection coefficients (dN/dS ratios) to identify regions under positive or purifying selection
-
Analyze syntenic relationships to trace gene duplication and rearrangement events
-
Compare gene structure (exon-intron organization) across species
-
-
Functional evolution:
The diversification of CASP genes likely reflects adaptation to different environmental conditions and developmental needs. Studying expression patterns across species and in response to various stresses could reveal how these genes have evolved specialized functions.
What is the optimal protocol for studying protein-protein interactions involving OsI_30044?
To comprehensively characterize protein-protein interactions involving OsI_30044, researchers should employ multiple complementary techniques:
-
In vitro interaction studies:
Pull-down assay protocol:
-
Express and purify recombinant OsI_30044 with an affinity tag (e.g., His-tag)
-
Immobilize the protein on an appropriate resin
-
Prepare plant extract or recombinant potential interacting proteins
-
Incubate with immobilized OsI_30044
-
Wash extensively to remove non-specific binding
-
Elute bound proteins and analyze by SDS-PAGE and mass spectrometry
Surface Plasmon Resonance (SPR):
-
Immobilize purified OsI_30044 on a sensor chip
-
Flow potential interaction partners over the chip
-
Measure association and dissociation kinetics
-
Calculate binding affinities (KD values)
-
-
In vivo interaction studies:
Co-immunoprecipitation (Co-IP):
-
Generate transgenic plants expressing tagged OsI_30044
-
Prepare protein extracts under non-denaturing conditions
-
Immunoprecipitate OsI_30044 using tag-specific antibodies
-
Identify co-precipitated proteins by mass spectrometry
Bimolecular Fluorescence Complementation (BiFC):
-
Fuse OsI_30044 to one half of a split fluorescent protein
-
Fuse potential interacting proteins to the complementary half
-
Co-express in plant cells (transient expression)
-
Visualize reconstituted fluorescence by confocal microscopy
Förster Resonance Energy Transfer (FRET):
-
Fuse OsI_30044 to a donor fluorophore (e.g., CFP)
-
Fuse potential interacting proteins to an acceptor fluorophore (e.g., YFP)
-
Co-express in plant cells
-
Measure energy transfer by acceptor photobleaching or fluorescence lifetime imaging
-
-
High-throughput screening:
Yeast Two-Hybrid (Y2H) screening:
-
Clone OsI_30044 into bait vector
-
Screen against a rice cDNA library in prey vector
-
Select positive interactions on selective media
-
Validate interactions by directed Y2H and alternative methods
Proximity-dependent biotin identification (BioID):
-
Fuse OsI_30044 to a biotin ligase (BirA*)
-
Express in plant cells
-
Proteins in proximity become biotinylated
-
Purify biotinylated proteins and identify by mass spectrometry
-
For all interaction studies, appropriate controls should be included to verify specificity and biological relevance of the interactions.
How can researchers quantitatively assess Casparian strip formation in plants with modified OsI_30044 expression?
Quantitative assessment of Casparian strip formation in plants with modified OsI_30044 expression requires a combination of imaging techniques, physiological assays, and molecular analyses:
-
Histochemical staining methods:
-
Berberine-aniline blue staining for suberin and lignin
-
Fluorol Yellow for suberin lamellae
-
Basic fuchsin for lignified cell walls
Quantification approach:
-
Image multiple root sections using standardized microscopy settings
-
Measure staining intensity using image analysis software
-
Quantify the continuity of the Casparian strip band
-
Determine the distance from the root tip to the first appearance of Casparian strip
-
-
Apoplastic tracer assays:
Protocol:
-
Incubate intact roots in solutions containing fluorescent tracers (e.g., propidium iodide)
-
Section roots and visualize tracer penetration by confocal microscopy
-
Measure the extent of tracer penetration into the stele
-
Calculate the percentage of blocked versus permeable endodermal cells
Data analysis:
Parameter Wild-type OsI_30044 Knockout OsI_30044 Overexpression Distance from root tip to Casparian strip (mm) X ± SD Y ± SD Z ± SD Propidium iodide penetration (% blocked cells) X ± SD Y ± SD Z ± SD Staining intensity (arbitrary units) X ± SD Y ± SD Z ± SD Transport capacity (ion uptake rate) X ± SD Y ± SD Z ± SD -
-
Electron microscopy analysis:
-
Prepare ultra-thin sections of root tissue
-
Perform transmission electron microscopy (TEM)
-
Measure Casparian strip dimensions (width, depth)
-
Assess ultrastructural features of the endodermal cell wall
-
-
Biochemical composition analysis:
-
Isolate endodermal tissue using laser capture microdissection
-
Analyze lignin and suberin content using gas chromatography-mass spectrometry
-
Quantify specific Casparian strip components
-
-
Gene expression correlation:
-
Measure expression of OsI_30044 and other CASP genes
-
Quantify expression of known Casparian strip biosynthetic genes
-
Correlate expression levels with Casparian strip development parameters
-
For robust quantification, researchers should:
-
Use multiple independent transgenic lines
-
Analyze plants at different developmental stages
-
Include appropriate controls (wild-type and known Casparian strip mutants)
-
Apply statistical methods to determine significance of differences
What are the key unanswered questions regarding OsI_30044 function in rice?
Despite the advances in understanding CASP proteins in rice, several key questions remain unanswered regarding the specific function of OsI_30044:
-
What is the precise localization of OsI_30044 within plant cells and tissues?
-
How does OsI_30044 expression respond to various biotic and abiotic stresses?
-
What are the direct protein interaction partners of OsI_30044?
-
How does OsI_30044 contribute to Casparian strip formation and function?
-
What are the phenotypic consequences of OsI_30044 knockout or overexpression?
-
Does OsI_30044 have functions beyond Casparian strip formation?
-
How is OsI_30044 expression regulated at the transcriptional and post-transcriptional levels?
-
What is the three-dimensional structure of OsI_30044 and how does it relate to its function?
Addressing these questions will require integrated approaches combining molecular genetics, protein biochemistry, cell biology, and physiological analyses.
How can research on OsI_30044 contribute to crop improvement strategies?
Research on OsI_30044 and related CASP proteins has significant potential to contribute to crop improvement strategies, particularly in addressing challenges related to environmental stresses and nutrient use efficiency:
