Recombinant Oryza sativa subsp. indica Casparian strip membrane protein OsI_16169 (H0219H12.8, OsI_16169, OSIGBa0097P08.13)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oryza sativa subsp. indica Casparian strip membrane protein OsI_16169 (UniProt ID: A2XU91) is a four-transmembrane domain protein critical for forming the Casparian strip (CS), an apoplastic barrier in plant roots . This protein, also termed OsCASP6, belongs to the Casparian strip membrane domain protein (CASP) family, which scaffolds lignin deposition machinery to establish CS integrity . Its recombinant form is produced in E. coli with an N-terminal His tag, enabling biochemical and functional studies .

Functional Role in Casparian Strip Formation

The Casparian strip is a lignin-based barrier in the root endodermis that prevents apoplastic diffusion. OsI_16169:

  • Localizes to the plasma membrane of endodermal cells, forming a scaffold for lignin-polymerizing enzymes like peroxidases and dirigent proteins .

  • Interacts with ESB1 (enhanced suberin1), ensuring precise CS deposition .

  • Knockout Effects: Disrupted CS formation leads to mineral imbalance and stunted growth under soil/hydroponic conditions .

Localization Dynamics

  • In rice roots, OsI_16169 initially localizes diffusely on endodermal plasma membranes but later concentrates at the CS site, coinciding with lignin deposition .

  • Transient expression assays confirm plasma membrane targeting via interactions with lipid rafts .

Evolutionary Conservation

  • CASPs are conserved across land plants and green algae, with OsI_16169 sharing structural motifs (e.g., MARVEL domains) critical for membrane scaffolding .

  • Mutations in extracellular loops (e.g., C168S, W164G) disrupt scaffold stability, highlighting conserved residues’ functional importance .

Biotechnological Applications

ApplicationUtility
Root Barrier StudiesUsed to dissect CS assembly mechanisms and nutrient transport regulation .
Protein Interaction AssaysFacilitates identification of CS-associated enzymes (e.g., peroxidases) via pull-down experiments .
Agricultural ResearchTargets for engineering drought-resistant rice via enhanced root barrier integrity .

Production and Purification

  • Expression: Full-length OsI_16169 (1-186 aa) is expressed in E. coli with >85% purity .

  • Reconstitution: Lyophilized protein is solubilized in Tris-based buffer with 50% glycerol for long-term storage at -80°C .

  • Quality Control: Validated via SDS-PAGE and immunoblotting .

Future Research Directions

  • Mechanistic Studies: Elucidate how OsI_16169 recruits lignin biosynthesis machinery.

  • Crystallography: Resolve 3D structure to guide synthetic biology applications.

  • Field Trials: Test transgenic rice lines with modified OsI_16169 expression under nutrient-stress conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
H0219H12.8; OsI_16169; OSIGBa0097P08.13; Casparian strip membrane protein 6; OsCASP6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
H0219H12.8
Target Protein Sequence
MEHGEISSKAPLVAPVAAGVNRAVAVVDTFLRFIAIIGTIGSAIAMGTTNETLPFFTQFI QFEAKYSDLPSFTFFVAANAVVCTYLVLSIPLSIVHILRPRARYSRLFLVFFDTAMLALL TAGASAAAAIVYLAHKGNVRANWFSICQQFDSFCERISGSLIGSFAAMVLLVVLITLSAF ALARRH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for the establishment of the Casparian strip membrane domain (CSD) and subsequent Casparian strip formation. Casparian strips are cell wall modifications in the root endodermis that create an apoplastic barrier between the internal and external apoplasm, preventing lateral diffusion.
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the known function of OsI_16169 in rice root development?

The OsI_16169 protein belongs to the Casparian strip domain protein family in rice, which plays a crucial role in the formation of Casparian strips at the endodermal cells in rice roots. Similar to other characterized CASPs like OsCASP1, this protein is likely essential for establishing the selective barrier that regulates mineral and water uptake in rice roots . The protein's function can be analyzed through knockout and overexpression studies, combined with phenotypic analyses focusing on root development and nutrient uptake efficiency. Researchers should consider examining both anatomical changes in endodermal tissue and physiological impacts on nutrient selectivity when characterizing this protein's function.

How can I effectively express recombinant OsI_16169 for functional studies?

For heterologous expression of OsI_16169, an Agrobacterium-mediated transformation approach has proven effective for similar Casparian strip proteins . When designing your expression construct, consider the following protocol:

  • Amplify the full-length ORF of OsI_16169 from indica rice varieties, using OSIGBa0097P08 BAC clone as a reference template

  • Clone the sequence into an appropriate plant expression vector such as pCAMBIA1301 under the control of a constitutive promoter

  • Transform the construct into Agrobacterium tumefaciens

  • Generate transgenic rice plants through standard protocols

  • Confirm successful transformation through PCR and expression through RT-PCR or Western blotting

For protein purification, consider adding an epitope tag that doesn't interfere with protein function to facilitate downstream purification and detection steps.

What expression pattern does OsI_16169 exhibit across different rice tissues?

Based on studies of related Casparian strip proteins in rice, OsI_16169 likely shows a tissue-specific expression pattern primarily in roots, with particular enrichment in the endodermal cell layer . To determine the precise expression pattern:

  • Perform quantitative real-time PCR (qRT-PCR) assays with total RNA isolated from various rice organs (roots, leaves, stems, leaf sheaths, and young panicles)

  • Complement qRT-PCR data with promoter-reporter fusion studies (e.g., pOsI_16169:GUS) to visualize spatial expression patterns

  • Consider examining expression at different developmental stages and under various environmental conditions

  • Use publicly available expression databases like the CREP database for comparative analysis with other tissue-specific genes

Based on related Casparian strip proteins, expect predominant expression in root tissues, particularly in zones where the endodermis is developing and maturing.

What are the most reliable methods to determine subcellular localization of OsI_16169?

To determine the subcellular localization of OsI_16169:

  • Generate fusion constructs with fluorescent reporters (GFP or YFP) at either the N- or C-terminal end

  • Test localization in both heterologous systems (protoplasts) and stable transgenic plants

  • Perform co-localization studies with known plasma membrane markers, as related CASP proteins typically localize to the plasma membrane in the Casparian strip domain

  • Confirm localization pattern through immunogold labeling and electron microscopy

  • Consider using BiFC (Bimolecular Fluorescence Complementation) to simultaneously assess protein-protein interactions and localization

For transient expression studies, rice protoplasts have been successfully used to visualize CASP protein localization and interactions .

How is OsI_16169 evolutionarily related to other characterized Casparian strip proteins?

To establish evolutionary relationships:

  • Perform comprehensive phylogenetic analysis using CASP protein sequences from diverse plant species

  • Focus particularly on comparing OsI_16169 with other characterized rice CASPs (OsCASP1-5)

  • Analyze sequence conservation in functional domains across monocots and dicots

  • Examine synteny in genomic regions containing CASP genes across Oryza species

Based on studies of related proteins, expect OsI_16169 to show higher homology to other rice CASPs than to Arabidopsis counterparts, with potential subfunctionalization within the rice CASP family .

What protein-protein interactions does OsI_16169 participate in, and how can these be experimentally verified?

OsI_16169 likely participates in critical protein-protein interactions for Casparian strip formation. Based on studies of related proteins like OsCASP1, which forms complexes with itself and OsCASP2 , consider investigating:

  • Self-association capabilities of OsI_16169

  • Interactions with other CASP family members

  • Potential interactions with regulatory proteins

To experimentally verify these interactions:

MethodAdvantagesLimitationsKey Considerations
Yeast Two-Hybrid (Y2H)Initial screening of multiple interactionsPotential false positivesUse full-length and domain-specific constructs
Bimolecular Fluorescence Complementation (BiFC)Visualizes interactions in plantaMay force interactionsTest in rice protoplasts and stable transformants
Co-immunoprecipitation (Co-IP)Confirms interactions in native conditionsRequires quality antibodiesUse epitope-tagged versions if antibodies unavailable
Pull-down assaysTests direct interactionsUses in vitro conditionsExpress proteins in E. coli or insect cells
FRET/FLIMQuantifies interaction strengthTechnically challengingRequires specialized microscopy equipment

When analyzing results, consider whether interactions are direct or mediated by other proteins, and whether they occur in specific cellular compartments or developmental stages.

How does knockout or overexpression of OsI_16169 affect plant phenotype and Casparian strip integrity?

Based on studies of related proteins, manipulation of OsI_16169 expression likely has significant phenotypic consequences. For example, knockout of OsCASP1 affects Casparian strip formation , while overexpression of other regulatory proteins like OsMed16 can lead to growth retardation and altered defense responses .

For comprehensive phenotypic analysis:

  • Generate both knockout (using CRISPR-Cas9) and overexpression lines

  • Examine growth parameters (root and shoot development, yield components)

  • Analyze cellular structure of endodermis through detailed microscopy

  • Test Casparian strip functionality using apoplastic tracer dyes

  • Measure selective uptake of mineral nutrients (particularly Ca and Si)

  • Perform transcriptomic analysis to identify downstream affected genes

When interpreting results, note that complete knockout may be lethal (as seen with OsMed16 ), necessitating the use of inducible or tissue-specific promoters for functional studies.

What transcriptomic changes occur when OsI_16169 expression is altered, and how should this data be analyzed?

Altered expression of OsI_16169 likely affects numerous downstream genes. To capture and analyze these changes:

  • Perform RNA sequencing on roots from wild-type, knockout, and overexpression lines

  • Include multiple developmental stages and possibly different growth conditions

  • Use DESeq2 or similar tools for differential expression analysis

  • Conduct Gene Ontology (GO) and pathway enrichment analyses

  • Validate key differentially expressed genes using qRT-PCR

  • Consider chromatin immunoprecipitation sequencing (ChIP-seq) to identify direct targets if OsI_16169 has regulatory functions

When analyzing transcriptomic data, pay particular attention to:

  • Genes involved in cell wall modification

  • Nutrient transporters and channels

  • Stress response genes (as seen with altered expression of OsMed16 )

  • Genes with known involvement in Casparian strip development in rice or Arabidopsis

How do abiotic stresses influence OsI_16169 expression and function?

Casparian strip integrity is crucial for plant stress responses, particularly those involving water and nutrient uptake. To investigate stress effects:

  • Expose rice plants to various abiotic stresses (drought, salinity, nutrient deficiency)

  • Monitor OsI_16169 expression using qRT-PCR at different time points after stress application

  • Examine protein abundance and localization changes under stress conditions

  • Compare stress responses between wild-type and OsI_16169-modified plants

  • Analyze root anatomical changes in response to stress

This research approach may reveal potential applications for improving rice stress tolerance, as has been demonstrated with other regulatory genes like OsMed16, which affects osmotic stress tolerance .

What are the optimal conditions for studying protein-lipid interactions involving OsI_16169?

Casparian strip proteins often interact with specific lipids to establish membrane domains. To study these interactions:

  • Generate purified recombinant OsI_16169 protein

  • Prepare artificial membrane systems with varying lipid compositions

  • Use biophysical techniques such as:

    • Lipid binding assays

    • Surface plasmon resonance

    • Microscale thermophoresis

  • Complement in vitro studies with lipidomic analysis of endodermal cells

When designing experiments, consider potential post-translational modifications that might affect lipid-binding properties.

How can CRISPR-Cas9 be optimized for efficient editing of OsI_16169?

For precise genome editing of OsI_16169:

  • Design multiple sgRNAs targeting conserved functional domains

  • Verify sgRNA specificity using tools like CRISPR-P 2.0

  • Construct vectors containing optimized sgRNAs and Cas9 for rice expression

  • Transform rice calli using Agrobacterium-mediated transformation

  • Screen transformants for editing events using PCR and sequencing

  • Characterize homozygous mutants for phenotypic analysis

Target selection considerations:

  • Focus on early exons to ensure loss-of-function

  • Avoid regions with high GC content

  • Check for potential off-target sites throughout the rice genome

  • Consider using base editors for precise nucleotide changes without double-strand breaks

What methodologies should be employed to study OsI_16169 involvement in mineral nutrient uptake?

Given the role of Casparian strips in selective nutrient uptake, comprehensive nutrient analysis is essential:

  • Grow wild-type and OsI_16169-modified plants under controlled nutrient conditions

  • Sample tissues at different developmental stages

  • Perform ICP-MS analysis for comprehensive mineral profiling

  • Conduct radiotracer studies to track uptake kinetics of specific elements

  • Use synchrotron X-ray fluorescence microscopy for in situ element localization

  • Complement these approaches with transcriptomic analysis focusing on nutrient transporters

When interpreting results, consider that Casparian strip proteins particularly affect uptake of elements like calcium and silicon in rice, as demonstrated for OsCASP1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.