Recombinant Oryza sativa subsp. indica Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. indica Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Oryza sativa subsp. indica Cytochrome b6-f complex subunit 4 (petD) is a genetically engineered protein derived from the cytochrome b6-f complex found in the thylakoid membranes of chloroplasts in plants like rice. This complex plays a crucial role in photosynthesis by mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and regulating state transitions in response to changes in light conditions .

Structure and Function of Cytochrome b6-f Complex

The cytochrome b6-f complex is composed of several subunits, with subunit IV (petD) being one of the key components. This complex is essential for the photosynthetic electron transport chain, contributing to the generation of ATP and NADPH during photosynthesis. The petD subunit, specifically, is involved in the assembly and stability of the complex .

Structure of petD Subunit

  • Location: Encoded by the plastid genome.

  • Function: Essential for electron transfer and complex stability.

  • Interactions: Forms critical interactions with other subunits, such as PetB (cyt b6), for proper complex assembly .

Recombinant Expression of petD

Recombinant expression of the petD subunit allows for the production of this protein in heterologous systems, such as E. coli, facilitating detailed biochemical and biophysical studies. This approach enables researchers to investigate the structure-function relationships of the cytochrome b6-f complex and its role in photosynthesis .

Recombinant Expression Details

Expression SystemTagOrganism
E. coliHis-tagBacteria

Research Findings and Applications

Research on the petD subunit has highlighted its importance in photosynthesis and plant development. Mutations in the petD gene can impair state transitions, affecting photosynthetic efficiency . Understanding these mechanisms can inform strategies to enhance crop productivity and resilience.

Key Findings

  • State Transitions: The petD subunit is crucial for state transitions, which regulate light energy distribution between PSII and PSI .

  • Electron Transport: Essential for electron flow between PSII and PSI, contributing to ATP synthesis .

  • Complex Assembly: Interacts with other subunits to ensure proper complex assembly and function .

References CUSABIO TECHNOLOGY LLC 제품 목록 - ChemicalBook PLOS ONE: Chloroplast Signal Recognition Particle 43 PMC: Role of the Low-Molecular-Weight Subunits PetL, PetG, and PetN PubMed: The stromal side of the cytochrome b6f complex regulates state transitions Creative Biomart: Recombinant Full Length Cytochrome b6-f complex subunit 4(petD) Protein PubMed: A stromal region of cytochrome b6f subunit IV is involved in state transitions Agrisera: Anti-PetD | Cytochrome b6-f complex subunit 4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; 9311097; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does the petD gene play in rice?

The Cytochrome b6-f complex is a crucial membrane protein complex involved in the electron transport chain during photosynthesis, acting as a link between Photosystem II and Photosystem I. In Oryza sativa, the petD gene encodes subunit 4 of this complex, which is essential for proper assembly and function of the entire complex. Methodologically, researchers can confirm the role of petD through reverse genetics approaches such as RNA interference or CRISPR-Cas9 gene editing, followed by phenotypic characterization of photosynthetic efficiency using pulse-amplitude modulation fluorometry. These techniques allow for quantitative assessment of electron transport rates when petD expression is altered.

How do expression systems for recombinant rice proteins differ, and which is optimal for petD expression?

Expression systems for recombinant rice proteins include bacterial (E. coli), yeast (Pichia pastoris, Saccharomyces cerevisiae), insect cells, and plant-based systems including homologous (rice) and heterologous (tobacco, Arabidopsis) hosts. For membrane proteins like Cytochrome b6-f complex components, expression systems that can properly fold and insert membrane proteins are preferred. Research indicates that recombinant proteins expressed in plant-based systems often show high chemical modification (CM) variability compared to yeast or bacterial systems . For petD specifically, a homologous rice expression system may provide proper folding and post-translational modifications, though researchers should be aware of potential glycation issues observed in rice-expressed recombinant proteins .

What analytical techniques are essential for confirming the identity of recombinant petD protein?

Essential analytical techniques include:

  • Size Exclusion Chromatography (SEC) for assessing protein homogeneity and detecting aggregates

  • Reversed-Phase High-Performance Liquid Chromatography (RP-HPLC) for purity analysis

  • Capillary Electrophoresis (CE) for charge variant analysis

  • Liquid Chromatography-Mass Spectrometry (LC-MS) for precise molecular weight determination and identification of post-translational modifications

  • Far U/V Circular Dichroism Spectropolarimetry for secondary structure assessment

  • Fluorescence Spectroscopy for tertiary structure analysis

These techniques, when used in combination, provide comprehensive characterization as demonstrated in recombinant protein analysis studies .

What typical yields can be expected when expressing recombinant petD in rice expression systems?

When expressing recombinant proteins in rice, yields can vary significantly based on promoter strength, codon optimization, and compartmentalization strategy. For membrane proteins like petD, yields typically range from 0.1-0.5% of total soluble protein when expressed in seed endosperm. Higher yields may be achieved through optimization of growth conditions and expression constructs. Researchers should establish quantification protocols using protein-specific antibodies in Western blot analyses or develop specific activity assays to accurately measure functional protein yields.

How can researchers address lot-to-lot variability in rice-expressed recombinant proteins like petD?

Addressing lot-to-lot variability requires robust quality control protocols:

  • Implement consistent growth conditions with controlled light/dark cycles to minimize variability in glycation

  • Develop comprehensive characterization panels including:

    • SEC for aggregation assessment

    • LC-MS peptide mapping for glycation profiling

    • CE for charge variant analysis

  • Establish acceptance criteria based on critical quality attributes

  • Perform functional assays to ensure consistent activity across lots

  • Consider the use of reference standards

Research on rice-expressed recombinant HSA has shown significant lot-to-lot variability, particularly in glycation patterns, which correlated with changes in tertiary structure and function . Similar variability may affect petD expression, necessitating thorough characterization of each production lot.

What strategies can improve the solubility and stability of recombinant petD during purification?

For membrane proteins like petD, solubility and stability present significant challenges. Effective strategies include:

  • Detergent screening protocol:

    Detergent ClassExamplesConcentration RangeApplication Stage
    Non-ionicDDM, Triton X-1000.5-2%Initial extraction
    ZwitterionicCHAPS, LDAO0.1-1%Purification
    Peptide-basedSMA, amphipolsAccording to manufacturerFinal formulation
  • Addition of stabilizing lipids matching native environment

  • Buffer optimization with osmolytes (glycerol, sucrose)

  • Temperature control during all purification steps

  • Use of styrene-maleic acid lipid particles (SMALPs) to maintain native lipid environment

Each preparation should be assessed for functionality using electron transport assays and structural integrity through circular dichroism and fluorescence spectroscopy methods demonstrated to be effective for monitoring protein stability .

How does glycation of recombinant proteins in rice affect structure and function, and how can this be monitored for petD?

Glycation in rice-expressed recombinant proteins occurs non-enzymatically between glucose and amino acid residues (primarily lysine and arginine) during expression. For petD, this may affect:

  • Tertiary structure: Glycation can alter protein folding and stability

  • Complex assembly: Modified residues may interfere with protein-protein interactions

  • Electron transport function: Active site modifications could impair catalytic activity

Monitoring approaches include:

  • LC-MS/MS analysis to identify specific glycated residues

  • Fluorescence spectroscopy to detect tertiary structural changes

  • Functional assays to assess electron transport activity

  • Thermal stability assessment using differential scanning calorimetry

Research on rice-expressed proteins has shown that glycation levels correlate with structural changes and may impact function . For petD, mapping potential glycation sites in silico before expression can identify critical residues that should be monitored post-expression.

What are the most effective strategies for incorporating recombinant petD into liposomes for functional studies?

Effective strategies include:

  • Preparation of liposomes with lipid compositions mimicking thylakoid membranes

  • Detergent-mediated reconstitution:

    • Solubilize purified petD in mild detergents

    • Mix with preformed liposomes

    • Remove detergent via dialysis or bio-beads

  • Direct incorporation during liposome formation

  • Use of nanodiscs for single-particle studies

Functionality can be assessed by measuring electron transfer using artificial electron donors/acceptors and spectrophotometric detection. Previous studies with membrane proteins have demonstrated that liposome composition significantly affects protein stability and function , suggesting that lipid optimization is critical for functional reconstitution of petD.

How can researchers differentiate between expression system-related modifications and native post-translational modifications in recombinant petD?

Researchers can differentiate modifications through:

  • Comparative MS/MS analysis between:

    • Native petD purified from rice thylakoids

    • Recombinant petD from various expression systems

    • Site-directed mutagenesis of potential modification sites

  • Metabolic labeling techniques to track modification pathways

  • Top-down proteomics workflow:

    • Intact protein mass analysis

    • Fragmentation of intact proteins

    • Modification mapping with spatial context

Research has shown that rice expression systems introduce extensive glycation not typically found in native proteins . For petD, careful analysis of modifications is essential to distinguish between native regulatory PTMs and expression artifacts.

What experimental design is most appropriate for investigating the impact of environmental stress on petD expression in Oryza sativa?

A comprehensive experimental design should include:

  • Factorial design with multiple stress variables:

    • Drought (controlled water limitation)

    • Temperature stress (gradient exposure)

    • Hypoxia (controlled submergence)

    • Light stress (intensity variation)

  • Time-course sampling to capture dynamic responses

  • Multi-level analysis:

    • Transcriptomics (RNA-seq) to quantify petD transcript levels

    • Proteomics to measure protein abundance

    • Post-translational modification analysis

    • Functional assays of electron transport

  • Statistical analysis using ANOVA with appropriate post-hoc tests

  • Validation experiments:

    • qRT-PCR for transcript levels

    • Western blotting for protein levels

    • Electron transport measurements for functional impact

This approach allows researchers to identify specific stress conditions that affect petD expression and function, potentially revealing regulatory mechanisms.

How should researchers design experiments to compare the function of native versus recombinant petD protein?

A robust comparative experimental design should include:

  • Preparation of both proteins:

    • Native petD: Isolated from rice thylakoids using mild detergents

    • Recombinant petD: Expressed in multiple systems (rice, yeast, bacteria)

  • Parallel characterization:

    • Structural analysis (CD spectroscopy, fluorescence)

    • MS-based modification mapping

    • Thermal stability assessment

    • Lipid binding profile

  • Functional assays:

    • Electron transport rates in reconstituted systems

    • Complex assembly efficiency

    • Response to regulatory factors

  • Statistical analysis:

    • Paired comparisons between native and each recombinant version

    • ANOVA for multi-system comparisons

    • Correlation analysis between structural parameters and function

This design allows for direct assessment of functional equivalence and identification of critical factors affecting recombinant protein activity.

What controls are essential when studying the effects of mutations in recombinant petD?

Essential controls include:

  • Wild-type recombinant petD expressed in the same system

  • Empty vector control

  • Site-directed mutation controls:

    • Conservative mutations (similar amino acid properties)

    • Non-functional mutations in known critical residues

    • Mutations in non-conserved regions

  • Expression level controls:

    • Western blot quantification

    • qRT-PCR for transcript levels

  • Protein stability controls:

    • Thermal denaturation curves

    • Limited proteolysis resistance

Each mutation should be assessed through multiple functional assays and structural analyses to distinguish between direct functional effects and indirect effects due to protein stability or assembly changes.

How can researchers resolve contradictory results in petD functional studies across different expression systems?

To resolve contradictory results:

  • Systematic comparison framework:

    • Standardize protein quantification methods

    • Use identical assay conditions across all samples

    • Prepare proteins from different expression systems in parallel

  • Modification analysis:

    • Compare post-translational modification profiles

    • Identify expression system-specific modifications that correlate with functional differences

  • Structural analysis:

    • Compare secondary and tertiary structures

    • Assess complex assembly efficiency

  • Meta-analysis approaches:

    • Pool data across multiple studies

    • Use statistical methods to account for inter-laboratory variation

  • Functional reconstitution:

    • Test proteins in identical membrane environments

    • Assess function in the presence of other complex components

This methodical approach can identify whether contradictions stem from intrinsic protein differences or experimental variables.

What statistical approaches are most appropriate for analyzing variability in petD expression across different rice varieties?

Appropriate statistical approaches include:

  • Mixed linear models that account for:

    • Genotype (fixed effect)

    • Environmental conditions (fixed or random effect)

    • Biological replicates (random effect)

  • Principal Component Analysis to:

    • Identify patterns in expression data

    • Correlate expression with other traits

  • Cluster analysis using:

    • Hierarchical clustering with Ward.D2 method

    • Gower's distance matrix for phenotypic data

  • ANOVA with Newman-Keuls test for comparing group means

  • Correlation analysis using correlation matrices to identify relationships between:

    • Expression levels

    • Functional parameters

    • Environmental variables

These approaches, demonstrated to be effective in rice research , allow for robust analysis of complex datasets with multiple sources of variation.

How should researchers interpret changes in glycation patterns of recombinant petD in different expression conditions?

Researchers should interpret glycation patterns by:

  • Mapping glycation sites to the protein structure:

    • Identify whether modifications occur near functional domains

    • Assess potential impact on protein-protein interactions

    • Evaluate accessibility of modified residues

  • Correlative analysis:

    • Link glycation patterns to expression conditions

    • Correlate glycation with structural parameters

    • Associate glycation with functional metrics

  • Comparative interpretation:

    • Compare to known glycation patterns in other rice proteins

    • Consider evolutionary conservation of modified residues

    • Assess potential physiological significance

Research has demonstrated that glycation in rice-expressed proteins correlates with structural changes and may influence function . Therefore, researchers should consider glycation not merely as an artifact but as a potentially significant factor affecting protein behavior.

What are the major challenges in achieving consistent expression of functional recombinant petD, and how can they be addressed?

Major challenges and solutions include:

  • Membrane protein solubility:

    • Challenge: Hydrophobic nature of petD

    • Solution: Fusion tags (MBP, SUMO) to enhance solubility; optimization of detergent extraction protocols

  • Complex assembly:

    • Challenge: petD functions as part of a multi-subunit complex

    • Solution: Co-expression with partner proteins; sequential reconstitution approaches

  • Post-translational modifications:

    • Challenge: Inconsistent glycation in plant systems

    • Solution: Controlled growth conditions; mutation of non-essential modification sites

  • Expression variability:

    • Challenge: Lot-to-lot and supplier-to-supplier variability

    • Solution: Standardized expression protocols; comprehensive QC testing

  • Functional assessment:

    • Challenge: Measuring electron transport in isolated subunits

    • Solution: Development of subunit-specific activity assays; reconstitution into liposomes

Each challenge requires systematic optimization, with careful documentation of conditions that yield consistent results.

How can researchers effectively purify recombinant petD while maintaining its native conformation?

Effective purification strategies include:

  • Gentle extraction protocol:

    • Use of mild detergents (DDM, digitonin)

    • Addition of lipids during extraction

    • Inclusion of stabilizing agents (glycerol, specific ions)

  • Affinity chromatography optimization:

    • N-terminal tags to avoid interfering with membrane domains

    • Cleavable tags to obtain native protein

    • On-column detergent exchange

  • Quality control checkpoints:

    • CD spectroscopy to monitor secondary structure

    • Fluorescence spectroscopy for tertiary structure assessment

    • Size exclusion chromatography to detect aggregation

  • Native-like environment maintenance:

    • Use of nanodiscs or amphipols for final formulation

    • Addition of thylakoid lipids during purification

    • Temperature control throughout process

This approach, integrating multiple analytical techniques, allows for monitoring of protein conformation throughout the purification process.

What strategies can overcome the challenge of petD aggregation during purification and storage?

Strategies to overcome aggregation include:

  • Buffer optimization:

    ComponentRange to TestPurpose
    pH6.5-8.0Stability optimization
    Salt100-500 mMElectrostatic screening
    Glycerol5-20%Stabilization
    Reducing agents1-5 mMPrevent disulfide formation
    Specific lipids0.1-0.5 mg/mlMimic native environment
  • Detergent screening and optimization:

    • Systematic testing of detergent types

    • Critical micelle concentration adjustments

    • Mixed detergent systems

  • Advanced formulation approaches:

    • Polymer-based stabilizers

    • Amphipathic compounds

    • Liposome reconstitution

  • Storage condition optimization:

    • Temperature stability profiling

    • Lyophilization feasibility

    • Cryoprotectant addition

Research on membrane proteins has shown that optimization of these parameters can significantly reduce aggregation and maintain functionality, as demonstrated by similar approaches with complex proteins .

What emerging technologies show promise for improving recombinant petD expression and characterization?

Promising emerging technologies include:

  • Cell-free expression systems:

    • Advantages: Rapid production, direct incorporation into nanodiscs or liposomes

    • Applications: High-throughput variant screening, incorporation of non-natural amino acids

  • Cryo-electron microscopy:

    • Advantages: High-resolution structural analysis without crystallization

    • Applications: Structure determination in native-like environments, conformational dynamics studies

  • Single-molecule techniques:

    • Advantages: Observation of individual protein behavior

    • Applications: Functional heterogeneity assessment, real-time conformational changes

  • CRISPR-based genomic integration:

    • Advantages: Precise control of expression locus

    • Applications: Generation of stable expression lines, physiological expression levels

  • Artificial intelligence approaches:

    • Advantages: Prediction of optimal expression conditions

    • Applications: Design of protein variants with improved stability, expression optimization

These technologies will enable more detailed understanding of petD structure-function relationships and facilitate optimization of expression systems.

How might the study of recombinant petD contribute to improving photosynthetic efficiency in rice?

Recombinant petD research can contribute to photosynthetic improvement through:

  • Structure-function analysis:

    • Identifying rate-limiting steps in electron transport

    • Mapping interactions with other complex components

    • Understanding regulatory mechanisms

  • Directed evolution approaches:

    • Screening for variants with enhanced electron transport rates

    • Selection for stability under stress conditions

    • Engineering optimal redox properties

  • Synthetic biology applications:

    • Redesigning electron transport pathways

    • Optimizing cytochrome b6-f complex assembly

    • Enhancing coupling with other photosynthetic complexes

  • Stress response engineering:

    • Understanding petD modifications under stress

    • Developing stress-resistant variants

    • Improving recovery mechanisms

Understanding gained from recombinant protein studies can inform targeted genetic modifications in crop plants, potentially leading to varieties with enhanced photosynthetic efficiency under diverse environmental conditions.

What interdisciplinary approaches might yield new insights into petD function and regulation?

Promising interdisciplinary approaches include:

  • Computational biology integration:

    • Molecular dynamics simulations of petD in membrane environments

    • Machine learning analysis of sequence-function relationships

    • Systems biology modeling of electron transport networks

  • Biophysics-biochemistry interface:

    • Single-molecule force spectroscopy to measure protein stability

    • Fast kinetics methods to resolve electron transfer steps

    • Advanced spectroscopic techniques to track conformational changes

  • Synthetic biology-structural biology combination:

    • Designer membrane scaffolds for optimized function

    • Minimal functional units for mechanistic studies

    • Chimeric proteins to map functional domains

  • Ecophysiology-molecular biology integration:

    • Field studies correlating petD variants with photosynthetic performance

    • Environmental response mapping of petD modifications

    • Adaptation pattern analysis across rice varieties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.