Recombinant Oryza sativa subsp. indica Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping includes normal blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSLGLIFLLYTMFVW WRDVLRESTLEGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWP PKGIGVLDPWEIPLLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVATVLLALVSTGFQ GMEYYQAPSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEA AAWYWHFVDVVRLFPFVSIYWWGGI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a critical component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does COX3 contribute to cellular respiration in rice?

COX3 forms part of the cytochrome c oxidase complex, which catalyzes the final step in the mitochondrial electron transport chain. This enzyme reduces molecular oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis. Similar to the bacterial system studied in Rhodobacter sphaeroides, COX3 in rice likely plays a role in the structural stability of the oxidase complex and contributes to its catalytic function in the reduction of O₂ and the oxidation of c-type cytochromes .

What genomic location contains the COX3 gene in rice?

The COX3 gene is located in the mitochondrial genome of Oryza sativa. In studies of rice genome organization, COX3 has been used as a reference gene for mitochondrial DNA copy number analysis. For example, when studying the Taichung 65 mitochondrial genome, researchers found that COX3 exists at a relative copy number of 22.80±2.96 compared to single-copy nuclear genes, indicating the multi-copy nature of mitochondrial genes in rice .

What are the key differences between COX3 in indica and japonica rice subspecies?

Genetic analysis has revealed distinct patterns in mitochondrial genes, including COX3, between indica and japonica rice subspecies. These differences have been utilized in evolutionary studies to understand the divergence between these two major rice subspecies. Molecular dating suggests that indica and japonica diverged approximately 0.1 million years ago, long before rice domestication began .

The variation in mitochondrial genes like COX3 has evolutionary significance and may contribute to differences in energy metabolism between the subspecies. When researchers constructed a haplotype network based on several mitochondrial genome fragments including COX3, they found that japonica accessions were only included in one haplotype (H1), while indica accessions were contained in two different haplotypes (H2 and H3), suggesting different evolutionary origins .

How has COX3 been used in phylogenetic studies of rice varieties?

COX3 has been employed as a genetic marker for analyzing the diversity of rice varieties, particularly in upland traditional rice. Researchers targeting the mitochondrial COX3 gene have been able to assess genetic diversity among rice varieties in regions such as Malaysian Borneo . The gene's relatively slow evolutionary rate makes it useful for distinguishing between major evolutionary lineages, while its conservation allows for reliable amplification across different rice varieties.

This approach has helped researchers understand the genetic relationships among traditional varieties and has implications for conservation of rice genetic resources. The methodology typically involves:

  • DNA extraction from leaf tissue

  • PCR amplification of the COX3 gene

  • Sequencing analysis

  • Comparative alignment and phylogenetic tree construction

What are the optimal conditions for storing and handling recombinant COX3 protein?

For research applications, recombinant Oryza sativa subsp. indica COX3 protein requires specific storage conditions to maintain its stability and activity:

Storage ParameterRecommended ConditionNotes
Short-term storage4°CUp to one week
Long-term storage-20°C or -80°CPreferred for extended storage
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Handling precautionAvoid repeated freeze-thaw cyclesCompromises protein integrity

Aliquoting the protein upon receipt is recommended to minimize freeze-thaw cycles. When working with the protein, it should be kept on ice and used immediately after thawing for optimal activity .

What methods can be used to assess COX3 activity in rice tissues?

Cytochrome c oxidase activity can be assessed using histochemical and biochemical approaches. One established method involves:

  • Histochemical assay: Tissue sections are incubated in a medium containing cytochrome c, diaminobenzidine (DAB), and sucrose in a Hepes buffer (pH 7.4). The reaction produces a visible precipitate at sites of COX activity.

  • Quantification: Activity can be measured by densitometry analysis of the histochemical reaction product or through spectrophotometric assays monitoring the oxidation of reduced cytochrome c.

  • Controls: Negative controls should be included by treating sections with COX inhibitors like sodium azide or by prior fixation with paraformaldehyde .

For more precise measurements, researchers have developed methods using calibrated standards of purified cytochrome c oxidase to create a scale for quantitative assessment of enzyme activity in tissues .

What approaches can be used to study protein-protein interactions involving COX3?

Investigating the interaction partners of COX3 in the cytochrome c oxidase complex and other potential interacting proteins can provide insights into its function and regulation. Several methodologies can be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against COX3 or epitope-tagged recombinant COX3 to pull down interacting proteins, followed by mass spectrometry identification.

  • Yeast two-hybrid (Y2H) screening: Although challenging for membrane proteins like COX3, modified Y2H systems or split-ubiquitin assays can be employed to detect interactions.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing fragments of fluorescent proteins to COX3 and potential interactors, interactions can be visualized in planta.

  • Blue Native PAGE: For studying intact protein complexes containing COX3 and identifying its assembly partners within the cytochrome c oxidase complex.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry can identify proteins in close proximity to COX3 in vivo .

What expression systems are most suitable for producing recombinant rice COX3?

Producing functional recombinant COX3 presents challenges due to its hydrophobic nature and mitochondrial origin. Several expression systems can be considered:

Expression SystemAdvantagesLimitationsConsiderations
E. coliHigh yield, cost-effectiveMay form inclusion bodiesRequires optimization for membrane protein expression
Yeast (S. cerevisiae, P. pastoris)Post-translational modifications, membrane insertionLower yield than E. coliBetter for functional studies
Insect cellsHigher eukaryotic systemMore complex, expensiveGood for structural studies
Plant expression systemsNative-like environmentTime-consumingIdeal for functional studies in homologous system

For functional studies, codon optimization for the selected expression system is crucial. Additionally, fusion tags (His, GST, MBP) can facilitate purification while potentially enhancing solubility .

How can researchers verify the structural integrity of recombinant COX3?

Ensuring that recombinant COX3 maintains its native structure is essential for functional studies. Multiple complementary approaches can be used:

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure content and compare with predictions based on the amino acid sequence.

  • Thermal Stability Assays: Such as differential scanning fluorimetry to evaluate protein folding stability.

  • Limited Proteolysis: Properly folded proteins often show distinct proteolytic patterns compared to misfolded variants.

  • Activity Assays: Measuring electron transfer capability in reconstituted systems.

  • Antibody Recognition: Using conformation-specific antibodies that recognize correctly folded epitopes.

  • Lipid Incorporation Tests: Assessing the protein's ability to incorporate into artificial membrane systems, which is crucial for membrane proteins like COX3 .

What are the emerging applications of CRISPR/Cas9 technology for studying COX3 function?

While direct editing of mitochondrial genes like COX3 using CRISPR/Cas9 remains challenging due to difficulties in delivering Cas9 to mitochondria, several alternative strategies show promise:

  • Nuclear-encoded regulators: Targeting nuclear genes that regulate COX3 expression or function.

  • Mitochondrial-targeted restriction endonucleases: Using TALENs or zinc-finger nucleases with mitochondrial targeting sequences.

  • RNA editing approaches: Modifying COX3 transcripts rather than the mitochondrial DNA itself.

  • Import of synthetic RNA: Developing systems to import guide RNAs into mitochondria.

  • Allotopic expression: Moving the COX3 gene to the nucleus with appropriate targeting sequences for mitochondrial import of the protein .

These approaches could help elucidate COX3 function through precise genetic manipulation, potentially revealing its role in rice growth, development, and stress responses.

How might comparative analysis of COX3 across rice varieties inform breeding strategies?

Comparative analysis of COX3 across diverse rice germplasm could provide valuable insights for breeding programs:

  • Mitochondrial efficiency: Variations in COX3 might contribute to differences in respiratory efficiency and energy production, potentially affecting yield potential.

  • Stress tolerance correlations: Specific COX3 variants might correlate with enhanced tolerance to environmental stresses like drought, salinity, or temperature extremes.

  • CMS system development: Understanding COX3 variations could contribute to the development of new cytoplasmic male sterility systems for hybrid rice production.

  • Mitochondrial-nuclear compatibility: Identifying optimal combinations of mitochondrial COX3 variants with nuclear genomes for maximizing heterosis in hybrid varieties .

Such analyses would require high-throughput sequencing of the mitochondrial genome across diverse germplasm collections and correlation of genetic variations with phenotypic data.

What are common pitfalls when working with recombinant COX3 and how can they be addressed?

Researchers frequently encounter challenges when working with recombinant COX3 due to its hydrophobic nature and complex function:

ChallengeCauseSolution
Poor expression yieldHydrophobic protein, toxicity to hostUse specialized expression strains, lower induction temperature, optimize codon usage
Protein aggregationImproper folding, lack of chaperonesInclude detergents or lipids during extraction, co-express with chaperones
Loss of activityDenaturation during purificationUse milder detergents, maintain cold temperature throughout purification
Inconsistent assay resultsVariable protein qualityStandardize purification protocol, include activity controls, use fresh protein preparations
Antibody cross-reactivityConserved epitopes across speciesDesign peptide antibodies to unique regions, validate with knockout controls

Additionally, working with membrane proteins like COX3 often requires optimization of solubilization conditions and reconstitution into appropriate lipid environments to maintain native structure and function .

How can researchers differentiate between direct and indirect effects when studying COX3 function?

Distinguishing direct from indirect effects in COX3 functional studies presents a significant challenge due to its central role in mitochondrial respiration. Methodological approaches to address this include:

  • Complementation studies: Expressing wild-type COX3 in systems with mutated or depleted COX3 to confirm direct causality.

  • Time-course experiments: Monitoring the temporal sequence of events following COX3 perturbation to distinguish primary from secondary effects.

  • Dose-response relationships: Varying the level of COX3 expression or inhibition to establish correlations with observed phenotypes.

  • Specific inhibitors: Using inhibitors that target different components of the respiratory chain to differentiate COX3-specific effects.

  • Multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics to build comprehensive models of COX3-dependent processes .

These approaches collectively can help researchers establish causality and determine which phenotypic effects directly result from COX3 function versus those that arise from downstream metabolic or signaling changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.